Recombinant Methylobacillus flagellatus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Definition and Production

The recombinant MscL protein is a full-length (1–139 amino acids), His-tagged variant of the mechanosensitive ion channel from Methylobacillus flagellatus, expressed in Escherichia coli . Key production details include:

ParameterSpecification
Source OrganismMethylobacillus flagellatus (strain KT/ATCC 51484/DSM 6875)
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C
Amino Acid SequenceMFKEFKAFAMRGNVVDMAVGIIIGAAFGAIVKSLVDDVIMPPIGLLLGNVDFSNLFIVLKDGAEVAPPYASVAAAQAAGAVTLNYGLFINAVVSFTIVAFAVFLLIRAINKLKAEEPAAPEVTPEDIVLLREIRDALKK

Functional Insights

MscL channels act as emergency valves during hypoosmotic shock, rapidly releasing solutes to prevent cell lysis . Key functional properties of the recombinant M. flagellatus MscL include:

  • Mechanosensitivity: Activated by membrane tension ≥10 mN/m .

  • Conductance: Large unitary conductance (~3.6 nS) .

  • Regulation:

    • Modulated by membrane lipid composition and amphipathic compounds (e.g., ramizol) .

    • Interactions with alternative ribosome-rescue factor (ArfA) sRNA link osmotic and translational stress responses .

A. Research Tools

  • Proteomic Studies: Detected in M. flagellatus proteomes under methanol/methylamine growth, confirming its role in methylotrophy .

  • Channel Gating Studies: Cysteine-scanning mutagenesis and electrophysiology reveal gating mechanisms .

B. Therapeutic Targets

  • Antibacterial Drug Development: MscL modulators (e.g., ramizol) inhibit bacterial growth by dysregulating osmotic balance .

A. Mutational Analysis

  • GndA/Fdh4A Mutants: Defective growth on methanol/methylamine, highlighting metabolic dependencies .

  • Cysteine Mutants: Sulfhydryl modifications alter gating thresholds, identifying critical pore-lining residues .

B. Comparative Genomics

  • M. flagellatus MscL shares functional homology with M. tuberculosis and E. coli MscL but exhibits distinct regulatory features (e.g., CRISPR-linked genes) .

Data Repositories

  • UniProt: Q1H3M0 (M. flagellatus MscL) .

  • BMRB: Entry 17448 (NMR structure of homolog YP_546394.1) .

  • GenBank: CP000284.1 (complete genome) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mscL; Mfla_0647; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
mscL
Target Protein Sequence
MFKEFKAFAMRGNVVDMAVGIIIGAAFGAIVKSLVDDVIMPPIGLLLGNVDFSNLFIVLK DGAEVAPPYASVAAAQAAGAVTLNYGLFINAVVSFTIVAFAVFLLIRAINKLKAEEPAAP EVTPEDIVLLREIRDALKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylobacillus flagellatus and why is its mscL protein of research interest?

Methylobacillus flagellatus is an obligate methylotroph belonging to the Betaproteobacteria class and Methylophilaceae family. This organism has a very limited substrate repertoire, growing robustly only on methanol or methylamine, with specific genomic lesions in pathways for multicarbon compound utilization, confirming its exclusive reliance on methylotrophy . The complete genome of M. flagellatus consists of a single circular chromosome of approximately 3 Mbp, potentially encoding 2,766 proteins .

The mscL protein (Large-conductance mechanosensitive channel) from M. flagellatus represents an interesting research target because mechanosensitive channels play critical roles in bacterial osmoregulation. Studying this protein in an obligate methylotroph with a highly specialized metabolism can provide insights into membrane protein adaptations in organisms with restricted metabolic capabilities.

How does the M. flagellatus mscL compare to mechanosensitive channels from other bacteria in terms of sequence and structure?

Methodological answer: To compare M. flagellatus mscL with homologs from other bacteria, researchers typically perform multiple sequence alignments using tools like MUSCLE or Clustal Omega. Structural comparisons would involve:

  • Extracting the mscL sequence from the annotated M. flagellatus genome (ATCC 51484)

  • Using BLAST searches against protein databases to identify homologs

  • Generating multiple sequence alignments to identify conserved domains

  • Constructing phylogenetic trees to establish evolutionary relationships

  • Using homology modeling tools (SWISS-MODEL, I-TASSER) to predict structural features based on crystallized mscL proteins from other bacteria

The context of such analysis should consider M. flagellatus' unique metabolic adaptations as an obligate methylotroph, which may influence membrane composition and potentially the functional properties of membrane proteins like mscL.

What expression systems are most suitable for recombinant production of M. flagellatus mscL?

When expressing recombinant M. flagellatus mscL, selecting an appropriate expression system requires considering several factors:

The expression construct should include affinity tags (His6, FLAG) for purification, with tags preferably at the C-terminus to avoid interference with membrane insertion.

What are the optimal conditions for solubilization and purification of recombinant M. flagellatus mscL?

Methodological approach for solubilization and purification:

  • Membrane fraction preparation:

    • Grow expression host to appropriate density

    • Induce mscL expression (typically with IPTG for T7 systems)

    • Harvest cells and disrupt by sonication or French press

    • Isolate membrane fraction by ultracentrifugation (100,000 × g)

  • Solubilization screening:

    • Test panel of detergents including:

      • Mild detergents: n-Dodecyl-β-D-maltoside (DDM), n-Decyl-β-D-maltoside (DM)

      • Medium strength: n-Octyl-β-D-glucopyranoside (OG)

      • Zwitterionic: LDAO, CHAPSO

    • Optimize detergent concentration, temperature, and time

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Size exclusion chromatography for further purification

    • Consider ion exchange chromatography if additional purity is required

  • Quality assessment:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for monodispersity

    • Circular dichroism for secondary structure verification

Consider analyzing the M. flagellatus membrane lipid composition, as proteomics studies have shown that 64% of the inferred proteome, including membrane proteins, can be detected during methylotrophic growth .

What functional assays can be used to characterize recombinant M. flagellatus mscL activity?

Several complementary approaches can be used to assess the functionality of recombinant M. flagellatus mscL:

  • Electrophysiology techniques:

    • Patch-clamp analysis of reconstituted channels in liposomes or proteoliposomes

    • Planar lipid bilayer recordings to measure single-channel conductance

    • Defining pressure threshold for channel activation

  • Fluorescence-based assays:

    • Calcein release assays from mscL-containing liposomes under osmotic shock

    • Voltage-sensitive dye assays to detect channel opening

    • FRET-based assays using labeled channel protein to detect conformational changes

  • In vivo functionality:

    • Complementation of mscL-deficient E. coli strains

    • Hypoosmotic shock survival assays

    • Growth phenotype analysis under osmotic stress conditions

  • Structural analyses:

    • Cysteine accessibility studies to map channel pore dimensions

    • Site-directed spin labeling combined with EPR spectroscopy

    • Cryo-EM analysis of purified channel in different conformational states

When designing these assays, consider the natural environment of M. flagellatus, which grows at high rates (up to 0.73 h⁻¹) on methanol or methylamine , potentially suggesting adaptation to specific osmotic conditions.

How can site-directed mutagenesis be used to investigate the structure-function relationship of M. flagellatus mscL?

Methodological approach for structure-function studies:

  • Key residue identification:

    • Perform sequence alignment with well-characterized mscL proteins

    • Identify conserved residues in transmembrane domains, pore region, and cytoplasmic domains

    • Prioritize residues based on predicted functional importance

  • Mutagenesis strategy:

    • Design primers for QuikChange or Q5 site-directed mutagenesis

    • Create systematic alanine scanning library across key domains

    • Generate charge substitutions at pore-lining residues

    • Introduce cysteine residues for accessibility studies

  • Functional characterization of mutants:

    • Express and purify mutant proteins using optimized protocols

    • Conduct electrophysiological analysis to determine:

      • Channel conductance

      • Gating threshold

      • Ion selectivity

      • Opening and closing kinetics

    • Perform in vivo complementation assays in E. coli

  • Data analysis:

    • Map mutations onto structural models

    • Correlate functional changes with structural locations

    • Develop a comprehensive model of channel gating mechanism

When interpreting results, consider potential adaptations of the channel to M. flagellatus' specific membrane composition, which may differ from model organisms due to its obligate methylotrophic lifestyle and limited metabolic flexibility .

How does the lipid environment affect the function of recombinant M. flagellatus mscL?

Methodological approach to investigating lipid-protein interactions:

  • Lipid composition analysis:

    • Characterize native M. flagellatus membrane lipids using LC-MS/MS

    • Compare lipid profiles between methanol and methylamine growth conditions

    • Identify key lipid species that may interact with mscL

  • Reconstitution experiments:

    • Prepare proteoliposomes with defined lipid compositions:

      • Varying acyl chain lengths

      • Different head groups

      • Cholesterol or hopanoid content

      • Curvature-inducing lipids

    • Measure channel activity in each lipid environment using electrophysiology

  • Molecular dynamics simulations:

    • Build in silico models of mscL in various lipid bilayers

    • Simulate membrane deformation and channel gating

    • Identify lipid binding sites and lipid-protein interactions

  • Lipid-protein crosslinking:

    • Use photoactivatable lipid analogs to identify specific lipid-binding sites

    • Map crosslinked residues by mass spectrometry

Given that M. flagellatus is specialized for growth on C1 compounds and exhibits high growth rates (up to 0.73 h⁻¹) , its membrane composition likely reflects adaptations to its unique metabolic lifestyle, which may influence mscL function compared to channels from metabolically versatile bacteria.

How does the mechanosensitive response of M. flagellatus mscL compare when expressed in different host organisms?

Systematic approach to comparative host expression studies:

  • Host selection rationale:

    • E. coli (model gram-negative bacterium)

    • Bacillus subtilis (model gram-positive bacterium)

    • Methylotrophic bacteria (e.g., Methylobacterium extorquens)

    • Archaeal expression systems (for extreme membrane compositions)

    • Eukaryotic cells (yeast or mammalian cell lines)

  • Expression strategy:

    • Design standardized expression constructs with consistent promoters and tags

    • Optimize codon usage for each host

    • Use fluorescent protein fusions to monitor localization

    • Create inducible expression systems for toxicity control

  • Functional characterization:

    • Electrophysiological analysis of channel properties in each host

    • Osmotic shock survival assays

    • Membrane tension sensitivity measurements

    • Protein-lipid interaction analyses

  • Data interpretation:

    • Correlate functional differences with host membrane composition

    • Analyze effects of post-translational modifications in different hosts

    • Consider the impact of interacting proteins unique to each host

Considering that proteomics studies of M. flagellatus identified 1,671 proteins (64% of the inferred proteome) , there might be specific interacting partners or lipid environments that influence mscL function in its native context versus heterologous hosts.

What insights can recombinant M. flagellatus mscL provide about bacterial adaptation to specialized metabolic niches?

Methodological approach to evolutionary and adaptive studies:

  • Comparative genomics framework:

    • Compare mscL sequences across methylotrophic bacteria

    • Analyze mscL from obligate versus facultative methylotrophs

    • Examine correlation between metabolic capabilities and mscL sequence features

    • Consider the genomic context of mscL in M. flagellatus relative to other bacteria

  • Environmental adaptation analysis:

    • Characterize mscL function under conditions mimicking natural habitats

    • Test channel response to specific stressors relevant to methylotrophic growth

    • Assess adaptation to fluctuations in methanol/methylamine availability

  • Molecular evolution studies:

    • Reconstruct ancestral sequences of mscL

    • Express and characterize ancestral proteins

    • Identify selective pressures on specific domains or residues

  • Systems biology integration:

    • Analyze co-expression patterns with other genes under stress conditions

    • Investigate potential interactions with methylotrophy-specific proteins

    • Develop models linking channel function to metabolic flux

This research would benefit from considering that M. flagellatus belongs to the Betaproteobacteria class and is most closely related to other members of the Methylophilaceae family, yet interestingly, its methylotrophy functions show greater similarity to those in Methylococcus capsulatus (a gammaproteobacterium) and Methylobacterium extorquens (an alphaproteobacterium) than to more closely related species, providing evidence for the polyphyletic origin of methylotrophy in Betaproteobacteria .

What strategies can overcome low expression yields of recombinant M. flagellatus mscL?

Methodological approach to improving expression yields:

  • Expression construct optimization:

    • Test multiple promoter systems (T7, tac, araBAD)

    • Optimize the ribosome binding site

    • Remove rare codons or use codon-optimized sequences

    • Try different fusion partners (MBP, SUMO, Mistic)

    • Test expression with and without signal sequences

  • Host strain engineering:

    • Use specialized membrane protein expression strains (C41/C43)

    • Consider strains with altered membrane characteristics

    • Try methylotrophic hosts that may provide a more natural membrane environment

    • Test cold-adapted expression hosts for slow folding

  • Growth and induction optimization:

    • Reduce induction temperature (16-20°C)

    • Test various inducer concentrations

    • Implement auto-induction media

    • Explore high cell-density fermentation

  • Protein stabilization strategies:

    • Add specific lipids to growth media

    • Include chemical chaperones (glycerol, DMSO)

    • Co-express molecular chaperones

    • Add ligands that might stabilize the protein

When optimizing expression, consider that comprehensive proteomics of M. flagellatus has successfully detected 1,671 proteins (64% of the inferred proteome) under methylotrophic growth conditions , suggesting that membrane proteins from this organism can be expressed and detected when appropriate conditions are used.

How can researchers address challenges in structural studies of recombinant M. flagellatus mscL?

Methodological strategies for structural characterization:

  • Sample preparation optimization:

    • Screen multiple detergents and detergent-lipid mixtures

    • Try amphipols, nanodiscs, or SMALPs as alternatives to detergents

    • Stabilize the protein in specific conformational states

    • Engineer constructs with enhanced stability (thermostabilizing mutations)

  • Crystallography approaches:

    • Implement crystallization in lipidic cubic phase

    • Use antibody fragments or nanobodies as crystallization chaperones

    • Explore fusion-protein approaches (T4 lysozyme insertion)

    • Implement surface entropy reduction

  • Cryo-EM strategies:

    • Optimize grid preparation (detergent concentration, blotting conditions)

    • Use Volta phase plates for contrast enhancement

    • Implement focused classification for conformational sorting

    • Consider scaffolding approaches (antibodies, nanobodies)

  • Alternative structural methods:

    • Solid-state NMR for membrane-embedded samples

    • DEER/EPR spectroscopy with site-directed spin labeling

    • Mass spectrometry-based footprinting and crosslinking

    • Hydrogen-deuterium exchange mass spectrometry

When planning structural studies, consider analyzing the similar approaches used for other membrane proteins from M. flagellatus, noting that its genome analysis has revealed multiple terminal cytochrome oxidases and various transport systems , providing comparative examples of membrane protein characterization from this organism.

What analytical methods can resolve contradictory functional data for recombinant M. flagellatus mscL?

Methodological framework for resolving inconsistent experimental results:

  • Systematic cause analysis:

    • Compare protein preparation methods between experiments

    • Evaluate detergent/lipid composition effects

    • Assess protein purity and potential contaminants

    • Consider post-translational modifications or proteolysis

  • Complementary technical approaches:

    • Validate channel activity using multiple independent methods

    • Combine electrophysiology with fluorescence-based assays

    • Implement label-free techniques (SPR, ITC) to confirm interactions

    • Use native mass spectrometry to assess oligomeric state

  • Controlled comparative studies:

    • Test channel function under identical conditions

    • Perform side-by-side characterization with well-studied mscL homologs

    • Use internal controls within each experiment

    • Implement blind experimental design when possible

  • Advanced data analysis:

    • Apply statistical methods to evaluate significance of differences

    • Use Bayesian approaches to integrate diverse data types

    • Develop mathematical models to explain apparently contradictory results

    • Implement machine learning for pattern recognition in complex datasets

Remember that M. flagellatus has adapted to a specialized metabolic niche as an obligate methylotroph with high growth rates on methanol or methylamine (up to 0.73 h⁻¹) , which may result in unique properties of its membrane proteins that might not follow patterns established for well-studied model organisms.

How can M. flagellatus mscL be engineered for enhanced functionality or novel applications?

Methodological approach to protein engineering:

  • Rational design strategies:

    • Modify gating threshold by altering hydrophobic pore residues

    • Engineer ligand-responsive variants by introducing binding domains

    • Create pH-sensitive channels through histidine substitutions

    • Design temperature-sensitive variants for controlled activation

  • Directed evolution methods:

    • Develop high-throughput screening for desired channel properties

    • Implement genetic selection systems based on osmotic survival

    • Use compartmentalized self-replication for in vitro evolution

    • Apply mRNA display for completely in vitro selection

  • Computational design approaches:

    • Use molecular dynamics to predict effects of mutations

    • Implement machine learning to design multi-point mutations

    • Apply Rosetta membrane protein design protocols

    • Develop physics-based models of channel gating for guided engineering

  • Novel application development:

    • Engineer biosensors for membrane tension

    • Develop controlled release systems

    • Create synthetic cellular osmoregulatory circuits

    • Design biomimetic materials with mechanoresponsive properties

When pursuing these engineering strategies, consider the genomic context of M. flagellatus, which shows evidence of lateral gene transfers and has genes with top BLAST hits from bacterial, archaeal, and eukaryotic sources , suggesting evolutionary plasticity that might be exploited in protein engineering approaches.

What role might M. flagellatus mscL play in the organism's adaptation to its methylotrophic lifestyle?

Methodological approach to linking channel function with ecological niche:

  • Ecological context analysis:

    • Compare mscL sequences from methylotrophs in different environments

    • Analyze gene expression under different methylotrophic growth conditions

    • Investigate potential co-evolution with methylotrophy-specific pathways

  • Experimental evolution studies:

    • Subject M. flagellatus to long-term adaptation under varying osmotic conditions

    • Track mutations in mscL and related genes

    • Correlate changes with growth efficiency on C1 compounds

  • In vivo functional studies:

    • Create mscL knockout or modification strains (if genetic tools are available)

    • Assess growth parameters under various osmotic regimes

    • Measure membrane tension during shifts in methylotrophic substrates

    • Analyze cellular responses to environmental fluctuations

  • Systems biology integration:

    • Perform transcriptomic and proteomic analysis under osmotic stress

    • Map interaction networks involving mscL and methylotrophy proteins

    • Develop metabolic models incorporating membrane adaptation mechanisms

This research should consider that M. flagellatus has redundant methylotrophy pathways, including multiple copies of methanol dehydrogenase homologs and both methylamine dehydrogenase and the N-methylglutamate pathway for methylamine oxidation , suggesting complex regulatory systems that might interface with membrane stress responses.

How might comparative studies of mscL channels from different methylotrophic bacteria inform our understanding of membrane protein evolution?

Methodological framework for evolutionary analysis:

  • Phylogenetic approach:

    • Construct comprehensive phylogenies of mscL proteins from diverse bacteria

    • Compare mscL and 16S rRNA phylogenies to identify horizontal gene transfer

    • Analyze selection patterns across different protein domains

    • Map key functional mutations onto the phylogenetic tree

  • Structure-function correlation:

    • Express and characterize mscL from diverse methylotrophs

    • Compare gating properties, conductance, and sensitivity

    • Correlate functional differences with sequence divergence

    • Identify convergently evolved features

  • Genomic context analysis:

    • Examine conservation of gene neighborhood across species

    • Identify co-evolving gene clusters

    • Analyze promoter regions for regulatory conservation

    • Map genomic islands containing mscL genes

  • Ancestral protein reconstruction:

    • Infer ancestral sequences at key evolutionary nodes

    • Express and characterize ancestral proteins

    • Identify critical mutations in evolutionary history

    • Test hypotheses about evolutionary trajectories

This research would be particularly informative given that genomic analysis of M. flagellatus has already provided evidence for the polyphyletic origin of methylotrophy in Betaproteobacteria, with methylotrophy functions more similar to those in Methylococcus capsulatus (a gammaproteobacterium) and Methylobacterium extorquens (an alphaproteobacterium) than to more closely related betaproteobacterial species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.