Recombinant Methylobacillus flagellatus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Role of YidC in M. flagellatus

YidC facilitates the insertion and folding of α-helical membrane proteins, acting as a chaperone to prevent misfolding. Key functions include:

  • Sec-independent insertion: YidC operates independently of the Sec translocase for substrates like the Pf3 coat protein .

  • Chaperoning: Accelerates folding of polytopic proteins (e.g., MelB permease) by stabilizing transient folding intermediates .

  • Energy efficiency: Catalyzes transmembrane insertion without ATP hydrolysis .

In M. flagellatus, YidC’s activity is essential for maintaining membrane integrity during rapid methanol or methylamine metabolism .

Recombinant Expression and Purification

Recombinant YidC from M. flagellatus can be produced using E. coli expression systems. A representative protocol includes:

  1. Cloning: Full-length yidC (1–541 aa) fused to an N-terminal His-tag.

  2. Expression: Induced in E. coli under optimized conditions (e.g., IPTG induction).

  3. Purification: Affinity chromatography (Ni-NTA) followed by gel filtration .

Key parameters for recombinant YidC:

  • Purity: >90% (SDS-PAGE verified) .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) .

Substrate Specificity

  • YidC preferentially inserts proteins with moderate hydrophobicity. Mutations in TM3/TM5 disrupt insertion of ATP synthase subunit a but not Sec-independent substrates like SciP .

  • Single-molecule force spectroscopy shows YidC accelerates folding of MelB’s pseudo-symmetric domains .

Biotechnological Relevance

  • Recombinant YidC aids in studying methylotrophic metabolism, particularly membrane enzyme assembly in M. flagellatus .

  • Used to reconstitute proteoliposomes for in vitro insertion assays .

Comparative Analysis with Homologs

OrganismYidC FeaturesSubstrate Examples
E. coliSecYEG collaboration; essential for viabilityF<sub>O</sub>c, Pf3 coat
Bacillus subtilisSec-independent; lacks PD domainCyoA, M13 procoat
M. flagellatusLikely dual Sec-dependent/independent roles; supports methylotrophyUncharacterized transporters

Unresolved Questions and Future Directions

  • Mechanistic details: How does M. flagellatus YidC interact with methylotrophy-specific transporters?

  • Structural gaps: High-resolution structure of M. flagellatus YidC remains uncharacterized.

  • Applications: Engineering YidC for synthetic biology (e.g., biofuel production) .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirement for the format, please indicate your preference when placing the order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is dependent on several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Mfla_2758; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
yidC
Target Protein Sequence
MDTKRLILFVIFSFSILMLWDSWQRDQQPPAASQTQTTAQSVEDGSVPQAAKSSASAANQ ASVPAETGFRLQSAERINVETDLYKASIDTIGGDLRRLELREHKDDEDQTKNFVLMDDQS APMLYVAQTGLIGNGLPTHKEVFTSESTNYQLAPGEDKLDVRLTWKGDNGVEVHKIYTFR RDSYAIEVSYEIRNNSDTAVDPSVYYQIVHDNQSHQGSYMMPTFTGGAYYTEADKYKKLS FSDMAKTNLSKNASDGWVGLVQHYFVSAWIPEDGLVREFYTKKLSDNVYSIGSVSPLGNI APGQSVTLKSRLYAGPQTQSELKSVAPGLEYTVDYGWLTVIATPLFWILSSIQKVVHNWG VAIILLTILIKLVFYPLSAASYRSMANMRELAPRLQRLKEQYGDDRQKLHQAMMEMYKTE KINPMGGCLPILVQIPVFIALYWVLLGSVEMRHAPFMLWIQDLSAVDPYYVLPILMGITM IIQTKLNPKPADPIQAKVMTIMPIVFSVFFFFFPAGLVLYWLVNNILSIAQQWYINRSTE RAAAKKKGNARR
Uniprot No.

Target Background

Function
Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of YidC in bacterial cells?

YidC is an essential insertase that facilitates the insertion and folding of proteins into the cytoplasmic cell membrane in bacteria. It can function independently or as part of the Sec holo-translocon to chaperone the integration of membrane proteins. Unlike previously thought, YidC's role extends beyond inserting small membrane proteins, as it has been demonstrated to promote the insertion and folding of complex polytopic membrane proteins, including transporters like lactose permease (LacY) and melibiose permease (MelB) . In Methylobacillus flagellatus, which relies exclusively on methylotrophy for growth, membrane protein insertion machinery plays a crucial role in maintaining proper cellular metabolism .

How accurately can computational methods predict the structure of YidC, and what insights do they provide?

Computational methods employing evolutionary co-variation analysis have proven remarkably effective in predicting YidC structure. When researchers built a model of E. coli YidC using covariation analysis and compared it with subsequently published crystal structures of Bacillus halodurans YidC2 (34% sequence identity with E. coli YidC), they found the root mean square deviation (RMSD) between the transmembrane helices to be approximately 7.5 Å (3WO6) and 7.3 Å (3WO7) . This level of accuracy falls within the resolution limits of the method and validates the computational approach. The predicted global arrangement of TM helices matched the crystal structure, with slight differences in the tilt angles relative to the membrane plane . These computational methods provide valuable insights into structural features that might be difficult to capture through crystallography alone, particularly regarding dynamic regions like the helical paddle domain.

What key residues and interactions stabilize the YidC structure in the membrane?

Molecular dynamics (MD) simulations have identified critical residues that stabilize YidC within the bacterial membrane. The five transmembrane helices form a rigid protein core, while the polar loop regions interact with the membrane surface . Hydrophobic residues on the exterior of the TM bundle stabilize interactions with the apolar lipid tails. Within the YidC core, both short and long-range interactions between the five helices provide structural integrity . The cytoplasmic side of the core contains primarily polar or charged residues engaged in strong electrostatic or charge-dipole interactions, while the periplasmic side features mainly aromatic residues involved in stacking and other nonpolar dispersion interactions . Functional studies have confirmed the importance of these stabilizing residues, as mutations of T362 in TM2 and Y517 in TM6 to alanine completely inactivated YidC despite the mutant proteins being stably expressed .

How does the helical paddle domain (HPD) contribute to YidC function, and how conserved is this feature?

The helical paddle domain (HPD), a cytoplasmic loop between TM2 and TM3 that forms a helical hairpin, shows interesting structural properties but appears to have limited functional necessity. Crystal structures and computational models indicate that this domain exhibits considerable flexibility, as evidenced by its high crystallographic B-factors and variable positioning in different structural models . Notably, the HPD is not essential for YidC function in E. coli, as its complete deletion does not compromise cell viability . This suggests that while the HPD may play a role in optimizing YidC activity, perhaps through interactions with ribosomes or other components of the insertion machinery, it is not strictly required for the core insertase function. The conservation pattern of this domain across different bacterial species could provide insights into its potential specialized roles in different organisms, including methylotrophs like Methylobacillus flagellatus.

How does YidC interact with ribosomes during co-translational membrane protein insertion?

Cryo-electron microscopy studies of YidC bound to ribosomes that are actively synthesizing membrane proteins have provided insights into the co-translational insertion mechanism. The interaction occurs where the newly formed protein chain exits the ribosome, with specific amino acids in YidC forming contacts with the ribosome . This strategic positioning allows YidC to receive the nascent membrane protein directly as it emerges from the ribosome exit tunnel. The structural model of YidC fitted into the cryo-EM density of the ribosome-YidC complex revealed specific contact points where the membrane protein might leave YidC and be inserted into the lipid bilayer . This co-translational insertion mechanism ensures that hydrophobic transmembrane segments are protected from the aqueous environment and properly guided into the membrane as they emerge from the ribosome.

What approaches can be used to express and purify recombinant YidC from Methylobacillus flagellatus?

Based on general principles for membrane protein purification, recombinant M. flagellatus YidC could be expressed using several systems. For bacterial expression, modified E. coli strains with reduced endogenous YidC or strains optimized for membrane protein expression (such as C41/C43 or Lemo21) would be suitable hosts. Expression should include an affinity tag (His6, FLAG, or Strep-tag) for purification, placed at either terminus after evaluating which position least affects function. Induction conditions should be optimized for temperature (typically 16-25°C for membrane proteins) and inducer concentration. Purification would involve membrane isolation by ultracentrifugation, solubilization with mild detergents (DDM, LMNG, or digitonin), and affinity chromatography. Further purification by size exclusion chromatography would enhance sample homogeneity. For functional studies, reconstitution into proteoliposomes or nanodiscs would provide a more native-like membrane environment than detergent micelles alone.

How can researchers determine if recombinant YidC is correctly folded and functional?

Several complementary approaches can verify the proper folding and function of recombinant YidC. Structural integrity can be assessed through circular dichroism spectroscopy to confirm secondary structure content, and thermal stability assays using differential scanning fluorimetry with environmentally sensitive dyes. Functional assays could include in vitro translation-insertion systems where the ability of purified YidC to facilitate insertion of model substrate proteins into liposomes is measured. Additionally, complementation assays in YidC-depleted E. coli strains (as described in the research for E. coli YidC mutants) can determine if recombinant M. flagellatus YidC can rescue the growth defect . Single-molecule force spectroscopy, as used with E. coli YidC and MelB, could provide detailed insights into the chaperone and insertase activities by monitoring how the recombinant protein affects the folding trajectory of substrate proteins .

What experimental approaches can be used to identify substrate proteins for M. flagellatus YidC?

To identify the substrate repertoire of M. flagellatus YidC, researchers could employ several complementary approaches. Proteomics analysis comparing membrane protein content in wild-type versus YidC-depleted M. flagellatus (using conditional expression systems) would reveal proteins dependent on YidC for membrane integration. This approach successfully identified 1,671 proteins (64% of the inferred proteome) in M. flagellatus during methylotrophic growth, demonstrating its effectiveness for proteome-wide studies in this organism . Cross-linking mass spectrometry using photo-activatable or chemical crosslinkers incorporated into recombinant YidC could capture transient interactions with substrate proteins. Additionally, genetic approaches such as synthetic genetic array analysis could identify genetic interactions between YidC and other genes, potentially revealing functional relationships with substrate proteins. For validation of specific substrates, in vitro translation-insertion assays with purified components would confirm direct YidC-dependent membrane integration.

How does YidC function compare between Methylobacillus flagellatus and other bacteria?

While the search results don't provide direct comparisons of YidC between M. flagellatus and other bacteria, general principles can be inferred. M. flagellatus has a very limited substrate repertoire, growing robustly only on methanol or methylamine, with specific lesions in pathways for utilization of multicarbon compounds . This metabolic specialization might be reflected in the substrate specificity of its membrane protein insertion machinery, including YidC. The proteome of M. flagellatus during methylotrophic growth shows significant overlap between methanol and methylamine growth conditions , suggesting that many of the same membrane proteins would require insertion machinery under both conditions. The redundancy observed in methylotrophy pathways of M. flagellatus might extend to membrane protein insertion pathways, potentially with specialized roles for YidC in inserting specific classes of transporters or enzymes essential for methylotrophic metabolism.

What structural and functional adaptations might YidC from M. flagellatus have compared to E. coli or B. halodurans YidC?

As a specialized methylotroph, M. flagellatus likely has adaptations in its membrane protein insertion machinery to accommodate its unique metabolic requirements. While the core function of YidC as an insertase would be conserved, subtle differences in the binding pocket or interaction surfaces might optimize it for M. flagellatus-specific membrane proteins. The helical paddle domain (HPD), which shows variability between E. coli and B. halodurans YidC , might have specific adaptations in M. flagellatus YidC related to its metabolic niche. Additionally, the residues identified as crucial for YidC stability and function in E. coli (such as T362 in TM2 and Y517 in TM6) would be interesting targets for comparative analysis in M. flagellatus YidC to determine if these functional hotspots are conserved across diverse bacterial lineages.

How might systems biology approaches enhance our understanding of YidC's role in M. flagellatus?

Systems biology approaches could provide comprehensive insights into how YidC integrates with the broader cellular machinery in M. flagellatus. Genome-wide association studies comparing different Methylobacillus strains might reveal co-evolving genetic elements that functionally interact with YidC. Network analysis integrating proteomics, transcriptomics, and metabolomics data could map the regulatory relationships between methylotrophic metabolism and membrane protein insertion pathways. The comprehensive proteomics approach that identified 1,671 proteins in M. flagellatus during methylotrophic growth provides a foundation for such analyses. Particular attention to nonrandom patterns observed with nondetectable proteins, which appeared to correspond to silent genomic islands , might reveal interesting relationships between genome organization, transcriptional regulation, and membrane protein insertion efficiency.

What role might YidC play in the adaptation of M. flagellatus to methylotrophic metabolism?

Given M. flagellatus' metabolic specialization for methylotrophy, YidC likely plays a critical role in ensuring proper insertion of membrane proteins essential for this lifestyle. The redundant methylotrophy pathways deduced from the M. flagellatus genome, including multiple homologs of methanol dehydrogenase, alternative systems for methylamine oxidation, and multiple terminal cytochrome oxidases , would require efficient membrane protein insertion machinery. YidC might be particularly important for inserting specialized transporters and oxidoreductases involved in the methanol and methylamine utilization pathways. The mutant analysis revealing that certain enzymes like GndA and FDH4 are crucial for M. flagellatus fitness while others (GndB and FDH1) are auxiliary suggests differentiated roles that might extend to membrane proteins inserted via YidC-dependent or independent pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.