Recombinant Methylobacillus flagellatus Methylamine utilization protein mauE (mauE)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Methylobacillus flagellatus Methylamine utilization protein MauE (mauE) is a genetically engineered protein derived from the obligate methylotroph Methylobacillus flagellatus KT. It plays a critical role in methylamine metabolism, specifically in the oxidation of methylamine to formaldehyde through the methylamine dehydrogenase (MADH) system . The recombinant form is expressed in Escherichia coli with an N-terminal His tag for purification purposes, ensuring high yield and stability .

ParameterDetails
UniProt IDQ50414
Gene LocusMfla_0548 (part of the mauFBEDAGLMN cluster)
Amino Acid Range1–188 aa
Expression HostE. coli
TagN-terminal His tag
Molecular Weight~20.7 kDa (calculated)
Purity>85% (SDS-PAGE verified)

Genetic Organization and Role in Methylamine Metabolism

The mauE gene is part of the mauFBEDAGLMN operon in M. flagellatus, which is essential for methylamine utilization . Key findings include:

  • Functional Role: MauE is implicated in electron transfer during methylamine oxidation, working in concert with MADH (composed of MauB and MauA subunits) .

Recombinant Expression and Purification

Recombinant MauE is produced using plasmid-based systems in E. coli, with protocols optimized for solubility and stability :

  • Cloning: Full-length mauE (1–188 aa) is cloned into expression vectors under strong promoters (e.g., T7).

  • Purification: Affinity chromatography (Ni-NTA) followed by size-exclusion chromatography ensures high purity .

  • Storage: Stable in Tris-based buffers with 50% glycerol at -20°C or -80°C .

Key Properties

  • Sequence: The mature protein contains conserved residues critical for interaction with MADH subunits .

  • Stability: Retains activity after repeated freeze-thaw cycles when stored in glycerol-containing buffers .

  • Interactions: Directly interacts with MauD and MauA to facilitate electron transfer in the MADH complex .

Functional Insights

  • Mutant Studies: M. flagellatus ΔmauE mutants fail to grow on methylamine and lack MADH activity, confirming its indispensability .

  • Proteomics Data: MauE is highly expressed during methylamine metabolism, alongside other mau operon proteins .

Applications

  1. Enzyme Mechanism Studies: Used to dissect electron transfer pathways in methylotrophic bacteria .

  2. Biotechnological Tool: Recombinant MauE aids in metabolic engineering of methylotrophs for single-carbon (C1) substrate utilization .

  3. Protein Interaction Networks: Serves as a model for studying multi-protein complexes in bacterial metabolism .

Challenges and Future Directions

  • Unresolved Questions: The exact role of MauE in MADH assembly remains unclear, warranting structural studies (e.g., X-ray crystallography) .

  • Engineering Potential: Optimizing MauE expression could enhance methylamine conversion efficiency in industrial biocatalysis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If a specific tag type is required, please inform us for preferential development.
Synonyms
mauE; Mfla_0549; Methylamine utilization protein MauE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
mauE
Target Protein Sequence
MSWLINDPTAAVLASLFIGIVLAAAAIPKFRHPDEFQGVVANYKLLPSFLVAPVAKLLPL VELLCAVALMIPPAREIAACVAAGLFIVFALALAINVGRGRTHIDCGCVRRPTSMSRIGM FHVMRAIALAGVSLYVAAVPVEFSRISIESGLMGLAAAAMLALLYMGADMLVGFPNSKND LLKGNTND
Uniprot No.

Target Background

Function
May be specifically involved in the processing, transport, and/or maturation of the MADH beta-subunit.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of mauE in Methylobacillus flagellatus?

mauE is a component of the methylamine utilization (mau) gene cluster in Methylobacillus flagellatus, which is a model obligate methanol and methylamine utilizer. The mau genes enable the bacterium to oxidize methylamine as a carbon and energy source through the methylamine dehydrogenase (MADH) system. This system catalyzes the oxidative deamination of methylamine to formaldehyde and ammonia. The genome of M. flagellatus contains the mau gene cluster that includes mauE, which is part of the methylamine dehydrogenase system that facilitates the utilization of methylamine as a substrate . Based on genomic analyses, mauE appears to be involved in the assembly or function of the MADH enzyme complex, working alongside the structural components (mauA and mauB) and other accessory proteins necessary for the proper assembly and function of the active enzyme complex.

How is mauE organized within the mau gene cluster of Methylobacillus flagellatus?

In Methylobacillus flagellatus, the mauE gene is part of the mau gene cluster that typically follows the mauFBEDAGLM arrangement. The mauE gene is positioned between mauB and mauD in this cluster. This organization can be compared to related methylotrophs such as Methylophilus methylotrophus W3A1, where eight open reading frames were identified in the mau gene cluster as mauFBEDAGLM . Interestingly, this organism's mau gene cluster lacks two genes (mauC and mauJ) that have been found in other methylotrophs between mauA and mauG. The genomic context of mauE suggests it functions in close association with other components of the methylamine utilization system, particularly with the structural genes encoding methylamine dehydrogenase.

How does the mauE gene contribute to methylotrophy in M. flagellatus?

The mauE gene in Methylobacillus flagellatus is an essential component of the methylotrophy pathway that allows this bacterium to utilize single-carbon compounds like methylamine. Methylotrophy in M. flagellatus is enabled by methanol and methylamine dehydrogenases and their specific electron transport chain components . The methylamine dehydrogenase system, which includes mauE, converts methylamine to formaldehyde, which is then further oxidized via the tetrahydromethanopterin-linked formaldehyde oxidation pathway. This process ultimately provides both carbon for assimilation and energy for cell growth.

M. flagellatus is an obligate methylotroph, meaning it can only grow on single-carbon compounds. This is due to its incomplete tricarboxylic acid cycle, as no genes potentially encoding alpha-ketoglutarate, malate, or succinate dehydrogenases are identifiable in its genome . The mauE gene, as part of the methylamine oxidation pathway, is therefore crucial for this organism's metabolism and survival.

What considerations are important when designing experiments to study mauE function?

When designing experiments to study mauE function, researchers should implement a structured approach that incorporates several key considerations:

  • Control Design: Proper controls are essential for valid interpretations. These should include:

    • Negative controls (mauE knockouts or inactive mutants)

    • Positive controls (known functional variants)

    • System controls to verify experimental conditions

  • Variable Isolation: A good experimental design requires significant planning to ensure control over the testing environment, proper experimental treatments, and appropriate assignment of subjects to treatment groups . For mauE studies, this means carefully controlling factors like:

    • Growth conditions (temperature, pH, nutrient availability)

    • Expression levels of mauE and related genes

    • Presence of cofactors or interacting proteins

  • Measurement Strategies: Multiple complementary approaches should be used to assess mauE function:

    • Direct enzymatic activity assays

    • Protein-protein interaction studies

    • Growth phenotype analyses in various conditions

  • Statistical Considerations: Experimental design should include proper statistical planning:

    • Adequate replication to achieve statistical power

    • Randomization to minimize bias

    • Factorial designs to identify interaction effects

  • Data Collection Plan: A comprehensive plan for analysis and reporting of results should be established before beginning experiments .

By implementing these considerations, researchers can design robust experiments that provide clear insights into mauE function while minimizing confounding variables and experimental artifacts.

How can I optimize expression of recombinant Methylobacillus flagellatus mauE protein?

Optimizing expression of recombinant mauE protein from Methylobacillus flagellatus requires systematic testing of multiple expression parameters:

Expression System Selection:

System TypeAdvantagesConsiderations for mauE
E. coli BL21(DE3)High yield, simple cultivationMay need codon optimization
Arctic ExpressBetter folding at low temperaturesSlower growth, lower yields
Methylotrophic hostsNative-like environmentMore complex cultivation
Cell-free systemsAvoids toxicity issuesHigher cost, lower yield

Key Optimization Parameters:

  • Vector Design:

    • Promoter selection (T7, tac, etc.)

    • Fusion tags to enhance solubility and purification (His6, MBP, SUMO)

    • Codon optimization for expression host

  • Culture Conditions:

    • Temperature: Test multiple temperatures (16°C, 25°C, 30°C, 37°C)

    • Growth media composition (LB, TB, minimal media with supplements)

    • Induction timing and inducer concentration

    • Duration of expression post-induction

  • Cell Lysis and Extraction:

    • Buffer composition (pH, salt concentration, additives)

    • Mechanical vs. chemical lysis methods

    • Inclusion of protease inhibitors

    • Solubilization strategies for inclusion bodies if necessary

  • Optimization Workflow:

    • Begin with small-scale expression tests (5-50 mL cultures)

    • Analyze total, soluble, and insoluble fractions

    • Confirm protein identity by Western blotting or mass spectrometry

    • Scale up optimized conditions for preparative expression

By systematically testing these parameters and analyzing protein yield, solubility, and activity, researchers can develop an optimized protocol for efficient expression of functional recombinant mauE protein.

What approaches can be used to assess the activity of recombinant mauE in vitro?

Assessing the activity of recombinant mauE protein requires appropriate functional assays based on its role in the methylamine utilization pathway:

Protein-Protein Interaction Assays:

  • Pull-down assays with other components of the MADH complex

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Co-immunoprecipitation with antibodies against mauE or partner proteins

Functional Reconstitution Approaches:

  • In vitro reconstitution of the MADH complex with purified components

  • Complementation assays in mauE-deficient bacterial strains

  • Activity measurements in the presence and absence of recombinant mauE

Biochemical Assays:

  • Electron transfer measurement using artificial electron acceptors

  • Spectroscopic methods to monitor changes in cofactor states

  • Coupled enzyme assays to detect activity-dependent product formation

Structural Assessment to Support Functional Studies:

  • Circular dichroism (CD) to assess proper protein folding

  • Limited proteolysis to identify stable domains

  • Thermal shift assays to evaluate protein stability

How does mauE from M. flagellatus compare to homologous proteins in other methylotrophic bacteria?

Comparative analysis of mauE across methylotrophic bacteria reveals important evolutionary and functional insights:

Sequence Conservation:
Mau polypeptides (including mauE) sequenced from different bacteria show considerable sequence identity, suggesting evolutionary conservation of function . Despite this conservation, there are significant differences in the organization and composition of mau gene clusters across species.

Phylogenetic Relationships:
Intriguingly, methylotrophy functions in Methylobacillus flagellatus (a betaproteobacterium) show more similarity to those in Methylococcus capsulatus (a gammaproteobacterium) and Methylobacterium extorquens (an alphaproteobacterium) than to the more closely related Methylibium petroleiphilum species . This provides genomic evidence for the polyphyletic origin of methylotrophy in Betaproteobacteria, suggesting horizontal gene transfer events rather than vertical inheritance.

Gene Cluster Organization:
The organization of mau genes varies between different methylotrophs:

  • In Methylobacillus flagellatus: The mau gene cluster includes the mauFBEDAGLM arrangement

  • In Methylophilus methylotrophus: The mau gene cluster lacks two genes (mauC and mauJ) that are present in other organisms

Functional Differences:
Different methylotrophic bacteria show variations in methylamine utilization strategies:

  • Methylobacillus flagellatus and Methylobacterium extorquens both possess additional methylamine dehydrogenase systems

  • Methylophilus methylotrophus W3A1-NS lacks an additional methylamine dehydrogenase system for amine oxidation

This comparative analysis highlights that despite sequence conservation, there are important differences in how mauE may function within the broader context of methylamine utilization across different bacterial species.

What insights can be gained from studying the evolution of mauE in different methylotrophs?

Studying mauE across different methylotrophic bacteria provides valuable evolutionary insights into the development of specialized metabolic pathways:

Evidence for Horizontal Gene Transfer:
The genome of M. flagellatus shows that methylotrophy functions are more similar to those in phylogenetically distant bacteria than to closely related species . This pattern strongly suggests that methylotrophy genes, including those encoding mauE, may have been acquired through horizontal gene transfer rather than vertical inheritance from a common ancestor. This challenges simple tree-like models of evolution and highlights the importance of lateral gene transfer in bacterial adaptation.

Modularity of Metabolic Pathways:
The variable organization of mau gene clusters across different methylotrophs suggests that these pathways can evolve in a modular fashion. For example, the absence of mauC and mauJ in some species indicates that components can be lost or gained while maintaining pathway functionality. This modularity may allow bacteria to adapt their methylotrophy capabilities to specific environmental niches.

Evolutionary Adaptation Patterns:
By comparing mauE sequences across diverse bacterial species, researchers can identify:

  • Conserved regions likely critical for core functions

  • Variable regions potentially involved in species-specific adaptations

  • Correlation between sequence variations and ecological niches

This evolutionary analysis provides insights into not only the history of metabolic innovation in bacteria but also practical guidance for engineering methylotrophy functions in synthetic biology applications.

What are common challenges in purifying recombinant mauE and how can they be addressed?

Purifying recombinant mauE to high levels of purity and activity requires addressing several common challenges:

Challenge 1: Low Solubility

  • Symptoms: Protein found predominantly in inclusion bodies

  • Solutions:

    • Lower expression temperature (16-20°C)

    • Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Test mild detergents for extraction if membrane-associated

Challenge 2: Protein Instability

  • Symptoms: Activity loss during purification, degradation bands on SDS-PAGE

  • Solutions:

    • Include protease inhibitors in all buffers

    • Minimize purification time and keep samples cold

    • Test stabilizing additives (glycerol, reducing agents, specific cofactors)

    • Purify under anaerobic conditions if oxygen-sensitive

Challenge 3: Co-purifying Contaminants

  • Symptoms: Persistent impurities after affinity purification

  • Solutions:

    • Implement multi-step purification strategy (affinity + ion exchange + size exclusion)

    • Optimize washing conditions for affinity chromatography

    • Consider on-column refolding for proteins purified from inclusion bodies

    • Use high-resolution techniques like hydrophobic interaction chromatography

Challenge 4: Low Yield

  • Symptoms: Insufficient protein recovery for downstream applications

  • Solutions:

    • Scale up culture volume

    • Optimize expression conditions for higher protein production

    • Improve efficiency of each purification step

    • Consider alternative expression systems if E. coli yields are consistently low

Purification Strategy Example:

Purification StepBuffer CompositionPurposeKey Optimization Points
Cell Lysis50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, protease inhibitorsExtract soluble proteinLysis method, buffer composition
IMAC (Ni-NTA)Above + 10-250 mM imidazole gradientInitial captureImidazole concentration in wash/elution
Ion Exchange20 mM HEPES pH 7.5, 50-500 mM NaCl gradientRemove contaminantspH selection based on pI of mauE
Size Exclusion25 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerolFinal polishing, buffer exchangeFlow rate, sample concentration

By systematically addressing these challenges, researchers can develop effective protocols for purifying functional recombinant mauE protein.

How can I reconcile conflicting data about mauE function across different studies?

When faced with conflicting data about mauE function, a systematic approach to reconciliation is essential:

Sources of Discrepancies in mauE Research:

Framework for Reconciling Conflicting Data:

  • Critical Evaluation of Methodologies:

    • Compare experimental protocols in detail

    • Assess validity of controls and statistical approaches

    • Evaluate reproducibility and robustness of measurements

  • Direct Comparative Studies:

    • Design experiments that directly compare mauE proteins under identical conditions

    • Include internal controls to normalize between experiments

    • Perform side-by-side testing of different preparation methods

  • Integrative Analysis:

    • Develop models that incorporate seemingly contradictory results

    • Consider whether different results reflect different aspects of a complex function

    • Use computational approaches to integrate diverse datasets

  • Collaborative Resolution:

    • Engage with authors of conflicting studies

    • Design consensus protocols

    • Participate in interlaboratory validation studies

By applying this systematic approach, researchers can develop a more nuanced understanding of mauE function that accommodates seemingly contradictory findings across different studies.

What techniques can be used to investigate the protein-protein interactions of mauE?

Investigating protein-protein interactions of mauE requires a multi-faceted approach using complementary techniques:

In Vitro Techniques:

  • Affinity-Based Methods:

    • Pull-down assays using tagged recombinant mauE

    • Co-immunoprecipitation with anti-mauE antibodies

    • Tandem affinity purification for complex isolation

  • Biophysical Characterization:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis for interaction studies with minimal sample consumption

    • Bio-layer interferometry for real-time binding analysis

  • Structural Approaches:

    • X-ray crystallography of mauE with interaction partners

    • Cryo-electron microscopy for larger complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Cross-linking coupled with mass spectrometry to identify proximity relationships

In Vivo and Cellular Techniques:

  • Genetic Approaches:

    • Bacterial two-hybrid assays

    • Suppressor mutation analysis

    • In vivo crosslinking followed by purification

  • Imaging Methods:

    • Förster resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation

    • Proximity ligation assays in fixed cells

  • Functional Correlation Studies:

    • Mutational analysis of putative interaction interfaces

    • Co-expression studies to assess functional interdependence

    • Comparative analysis across species with different mau gene organizations

By combining multiple techniques, researchers can build a comprehensive understanding of how mauE interacts with other components of the methylamine utilization machinery, particularly in the context of the mauFBEDAGLM gene cluster organization found in M. flagellatus .

How can genome editing techniques be applied to study mauE function in Methylobacillus flagellatus?

Genome editing provides powerful approaches to study mauE function directly in Methylobacillus flagellatus:

CRISPR-Cas9 System Adaptation:
CRISPR-Cas9 technology can be adapted for use in M. flagellatus by:

  • Optimizing codon usage of Cas9 for expression in M. flagellatus

  • Designing sgRNAs targeting mauE with minimal off-target effects

  • Developing efficient transformation protocols for M. flagellatus

  • Engineering suitable selection markers for identifying edited strains

Editing Strategies for Functional Analysis:

  • Gene Knockout:

    • Complete deletion of mauE to assess essentiality

    • Analysis of growth phenotypes on different carbon sources

    • Metabolic profiling to identify pathway disruptions

  • Point Mutations:

    • Introduction of specific mutations to test structure-function hypotheses

    • Creation of catalytically inactive variants

    • Modification of predicted interaction interfaces

  • Domain Swapping:

    • Replace domains with homologous regions from other methylotrophs

    • Engineer chimeric proteins to test functionality of specific regions

    • Introduce reporter tags for localization and interaction studies

  • Regulatory Modifications:

    • Alter promoter strength to study dosage effects

    • Create inducible expression systems for temporal control

    • Modify regulatory elements to study transcriptional control

Validation and Characterization Methods:

  • PCR and sequencing to confirm genomic modifications

  • Western blotting to verify protein expression levels

  • RNA-seq to assess transcriptional effects

  • Metabolomics to characterize pathway functions

  • Growth assays under various conditions to assess phenotypic effects

Drawing from the experience with mouse genome editing , researchers can adapt similar principles for bacterial systems while accounting for the specific challenges of working with methylotrophic bacteria.

What are the broader implications of understanding mauE function for microbial metabolism research?

Understanding mauE function in Methylobacillus flagellatus has significant implications for broader research in microbial metabolism:

Environmental Carbon Cycling:
Methylotrophic bacteria like M. flagellatus play crucial roles in global carbon cycling by metabolizing methanol and methylated amines, which are important biogenic atmospheric constituents . Understanding the molecular mechanisms of methylamine utilization, including the role of mauE, provides insights into these global biogeochemical processes.

Evolutionary Insights:
The polyphyletic origin of methylotrophy revealed through comparative genomics of mauE and other methylotrophy genes demonstrates the complex evolutionary history of metabolic pathways. This challenges traditional views of linear evolution and highlights the importance of horizontal gene transfer in bacterial adaptation.

Biotechnological Applications:
Detailed understanding of mauE function can enable:

  • Engineering more efficient biocatalysts for converting single-carbon compounds

  • Developing biosensors for environmental monitoring of methylated compounds

  • Creating synthetic biology tools based on methylotrophy pathways

  • Improving bioremediation strategies for methylated pollutants

Fundamental Biochemistry:
mauE research contributes to our understanding of:

  • Protein complex assembly and function

  • Electron transfer mechanisms in bacterial metabolism

  • Specialized metabolic adaptations for unusual carbon sources

  • Structure-function relationships in metabolic enzymes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.