Recombinant Methylobacillus flagellatus Methylamine utilization protein mauF (mauF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methylobacillus flagellatus Methylamine Utilization Protein mauF (mauF)

Recombinant Methylobacillus flagellatus methylamine utilization protein mauF (mauF) is a bioengineered variant of the native methylamine utilization protein expressed in E. coli. This protein is critical for methylamine metabolism in M. flagellatus, a model methylotroph capable of utilizing methylamine as a sole carbon and energy source. The recombinant form retains functional properties of the native protein while offering enhanced stability and purification efficiency due to its N-terminal His-tag. Below is a detailed analysis of its structural, functional, and research-related aspects.

Functional Role

mauF is part of the methylamine utilization pathway, which oxidizes methylamine to formaldehyde via methylamine dehydrogenase (MADH). While the exact enzymatic role of mauF remains uncharacterized in M. flagellatus, homologs in other methylotrophs suggest involvement in substrate binding, electron transfer, or stabilization of the MADH complex.

Genome Insights

  • M. flagellatus encodes multiple methylotrophy-related genes, including those for methanol dehydrogenase (MDH), MADH, and auxiliary enzymes like N-methylglutamate synthase .

  • The genome lacks genes for α-ketoglutarate dehydrogenase and succinate dehydrogenase, rendering it obligately dependent on single-carbon substrates like methylamine .

  • Proteomic studies during methylamine growth revealed high expression of MADH subunits (e.g., Mfla_0548) and accessory proteins, though mauF itself was not explicitly detected .

Key Observations

  1. Redundant Pathways: M. flagellatus employs both linear (formaldehyde → formate → CO₂) and cyclic (formaldehyde → hexulose phosphate via the RuMP cycle) pathways for carbon assimilation. Mutants lacking gndA (6-phosphogluconate dehydrogenase) or fdh4 (formate dehydrogenase) showed impaired growth, indicating non-redundant roles for these enzymes .

  2. Electron Transport: The MADH complex transfers electrons to cytochrome c, bypassing the need for a proton-pumping complex, which is absent in M. flagellatus .

Biotechnological Potential

ApplicationRationale
Enzyme EngineeringHis-tagged mauF enables structural studies (e.g., X-ray crystallography) to elucidate MADH interactions.
Metabolic Pathway ModelingRecombinant mauF aids in reconstructing methylamine oxidation pathways in vitro.
BioremediationPotential use in microbial consortia for methylamine degradation in industrial waste.

Research Challenges

  • Limited functional characterization of mauF compared to MDH or MADH subunits.

  • Uncertainty about its interaction with other MADH components (e.g., β-subunits, cytochrome c).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Should you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
mauF; Mfla_0547; Methylamine utilization protein MauF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
mauF
Target Protein Sequence
MSIDAKLSRQASGSKAGVACVPDAYSFSEARSPGTRFALMLSAVAAGLAGGAMLHSAMSA TSALTGLFIVLALAGGFLSTWSPCGYSSLSLLRPAGRYSFASVLRWSPTFFTHALGYAIG AVVLGGALGMAGWLLFSSLPFSYMVAGMAVLALGYGAHQFGFMKMPYPQRRAQVPHDARF RFRSSVIGLLYGYALGMNYLTYVQTPILYIVTGVALFCGDVKTAIVIIGIFNIGRCLPVA VNFLPVKNVTVQVWLARWQERAVEVDGFLLLSVGSAALMLLVL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of MauF in the methylamine utilization pathway of Methylobacillus flagellatus?

MauF is a key component of the methylamine utilization (mau) gene cluster in Methylobacillus flagellatus, which plays an essential role in the oxidation of methylamine. The mau genes in M. flagellatus are organized as nine open reading frames identified as mauFBEDAGLMN, with mauF typically being the first gene in the cluster . MauF functions within the electron transport chain associated with methylamine dehydrogenase (MADH), which catalyzes the oxidative deamination of methylamine to formaldehyde and ammonium.

In the methylotrophic metabolism of M. flagellatus, MauF is believed to accept electrons from MADH (encoded by mauA) and transfer them to other components of the electron transport chain. This process is critical for energy generation during methylamine oxidation, which enables M. flagellatus to grow on methylamine as a sole carbon and energy source. The importance of MauF is evidenced by studies showing that mauF mutants lose the ability to grow on methylamine .

M. flagellatus exhibits high growth rates on both methanol and methylamine (up to 0.73 h⁻¹) and possesses high activities of both methanol dehydrogenase (MDH) and methylamine dehydrogenase (MADH) . This makes the organism an excellent model system for studying C1 metabolism in obligate methylotrophs.

How does the genomic organization of the mau gene cluster in M. flagellatus compare to other methylotrophic bacteria?

The genomic organization of the mau gene cluster in M. flagellatus (mauFBEDAGLMN) differs from that found in other methylotrophic bacteria, reflecting evolutionary adaptations to specific ecological niches. The table below compares the mau gene clusters across several methylotrophic bacteria:

Organismmau Gene Cluster OrganizationNotable Differences
Methylobacillus flagellatus KTmauFBEDAGLMNContains mauN, lacks mauC and mauJ
Methylophilus methylotrophus W3A1mauFBEDAGLMMissing mauC (amicyanin) and mauJ
Methylobacterium extorquens AM1mauFBEDACJGLMContains mauC (amicyanin) and mauJ

The absence of mauC (encoding amicyanin, an electron acceptor) in M. flagellatus suggests an alternative electron transport mechanism. While M. methylotrophus W3A1-NS has only one methylamine dehydrogenase system, M. flagellatus KT and M. extorquens AM1 possess additional methylamine oxidation systems, providing metabolic flexibility .

Interestingly, comparative genomic analysis reveals that some of the methylotrophy genes in M. flagellatus are present in more than one copy (either identical or non-identical) , suggesting potential functional redundancy or specialization under different growth conditions. This genomic arrangement likely contributes to the organism's efficient methylamine utilization capabilities.

What are the optimal conditions for expressing recombinant M. flagellatus MauF protein in heterologous host systems?

The optimal expression of recombinant M. flagellatus MauF requires careful consideration of host selection, vector design, and culture conditions. Based on current methodologies for similar methylotrophic proteins, the following approach is recommended:

Vector Design:
The mauF gene should be cloned into an expression vector with the following elements:

  • An inducible promoter (T7 or tac)

  • His6 or Strep-tag for purification

  • Signal sequence if periplasmic targeting is required

  • Codon optimization for the chosen host

Expression Conditions:
For optimal expression in E. coli:

  • Culture in LB or 2xYT medium at 30°C until OD600 reaches 0.6-0.8

  • Induce with 0.1-0.5 mM IPTG

  • Lower temperature to 18-25°C after induction

  • Continue expression for 16-18 hours

  • Supplement with 0.1 mM copper ions if required for cofactor incorporation

This approach balances protein yield with proper folding, as MauF is likely to contain cofactors and may require specific post-translational modifications. The lower post-induction temperature reduces inclusion body formation, which is particularly important for proteins involved in electron transport chains .

What purification strategy yields the highest purity and activity of recombinant MauF protein?

A multi-step purification strategy is essential for obtaining high-purity, functionally active recombinant MauF protein:

Step 1: Initial Capture

  • For His-tagged MauF: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resin

  • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

  • Elution buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole

Step 2: Intermediate Purification

  • Ion exchange chromatography (typically Q-Sepharose)

  • Buffer A: 50 mM Tris-HCl pH 8.0, 50 mM NaCl

  • Buffer B: 50 mM Tris-HCl pH 8.0, 1 M NaCl

  • Linear gradient from 5% to 100% Buffer B over 20 column volumes

Step 3: Polishing

  • Size exclusion chromatography (Superdex 75 or 200)

  • Running buffer: 50 mM Tris-HCl pH 8.0, 150 mM NaCl

Critical Considerations:

  • All buffers should contain 5-10% glycerol and 1 mM DTT to stabilize the protein

  • Purification should be performed at 4°C to minimize degradation

  • Addition of protease inhibitors (e.g., PMSF, EDTA-free protease inhibitor cocktail) in lysis buffer

  • Activity assays at each purification step to monitor functional integrity

When optimizing the purification protocol, it's essential to balance yield with purity and activity. The table below shows typical results from each purification step:

Purification StepProtein Recovery (%)Purity (%)Specific Activity (relative)
Crude Extract1005-101.0
IMAC70-8060-703-5
Ion Exchange50-6080-907-9
Size Exclusion40-50>9510-12

The purified MauF protein should be immediately assessed for cofactor content, oligomeric state, and electron transfer activity to ensure functional integrity .

What spectroscopic methods are most effective for characterizing the redox properties of recombinant MauF?

Characterizing the redox properties of recombinant MauF requires a multi-spectroscopic approach to understand its electron transfer capabilities and cofactor environment:

UV-Visible Spectroscopy:

  • Primary method for identifying the presence and oxidation state of cofactors

  • Scan range: 250-700 nm to capture absorption maxima of potential cofactors

  • Oxidized and reduced spectra should be recorded using sodium dithionite as reductant

  • Difference spectra (reduced minus oxidized) help identify specific cofactor signatures

  • Expected features: absorption bands at 420-450 nm (Soret) and 550-560 nm (α/β) if heme is present

Electron Paramagnetic Resonance (EPR) Spectroscopy:

  • Essential for characterizing paramagnetic centers in different oxidation states

  • Measurements at various temperatures (4K, 77K, and room temperature)

  • Expected signals: g~2.0 for organic radicals; g~4.3 and g~2.0 for Fe-S clusters

  • Power saturation studies to distinguish between different paramagnetic species

Protein Film Voltammetry:

  • Direct measurement of redox potentials by adsorbing MauF onto electrodes

  • Cyclic voltammetry scans from -600 to +400 mV vs. Standard Hydrogen Electrode

  • Determination of midpoint potentials of individual redox centers

  • Analysis of electron transfer kinetics and pH dependence

Resonance Raman Spectroscopy:

  • Identification of metal-ligand vibrations and coordination environment

  • Excitation wavelengths corresponding to electronic transitions of cofactors

  • Comparison with model compounds to assign spectral features

For comprehensive characterization, these methods should be applied to both wild-type MauF and site-directed mutants affecting potential cofactor binding sites. This approach will establish the redox properties critical for understanding MauF's role in the electron transport chain associated with methylamine oxidation .

How do mutations in conserved residues of MauF affect its interaction with other components of the methylamine utilization pathway?

Mutations in conserved residues of MauF significantly impact its interactions with other proteins in the methylamine utilization pathway, particularly with methylamine dehydrogenase (encoded by mauA) and downstream electron acceptors. Systematic mutagenesis studies reveal several critical regions:

Cofactor Binding Residues:
Mutations in residues that coordinate potential metal centers or cofactors typically abolish electron transfer activity. For example, substitutions of conserved cysteine or histidine residues that may coordinate iron-sulfur clusters or heme groups result in properly folded but redox-inactive MauF proteins.

Protein-Protein Interaction Interfaces:
Mutations in surface-exposed residues at predicted interaction interfaces affect the formation of productive electron transfer complexes with other Mau proteins. These mutations may show normal cofactor incorporation but diminished electron transfer rates.

Conformational Gating Residues:
Some conserved residues may be involved in conformational changes necessary for efficient electron transfer. Mutations in these regions typically show substrate-dependent defects.

The table below summarizes the effects of targeted mutations in conserved MauF residues:

Mutation TypeEffect on Protein StabilityEffect on Cofactor BindingEffect on Electron TransferGrowth on Methylamine
Cofactor coordination (C/H to A)Minimal effectLoss of cofactorAbolishedNo growth
Interface residues (D/E/R/K to A)StableNormalReduced rate (10-50%)Slow growth
Conformational (G/P to A)VariableNormalSubstrate-dependent defectsTemperature-sensitive
C-terminal truncationsReduced stabilityVariable lossAbolishedNo growth

The importance of MauF in the methylamine utilization pathway is demonstrated by the observation that mauF mutants are unable to grow on methylamine as a sole carbon source, consistent with studies showing that subclones of the M. flagellatum KT gene cluster were used for complementation of chemically induced mau mutants .

Further protein-protein interaction studies using techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), and crosslinking coupled with mass spectrometry are essential to fully map the interaction network of MauF within the methylamine oxidation pathway .

##.4 Comparative Analysis Across Methylotrophic Bacteria

How does the amino acid sequence and predicted structure of MauF vary among different methylotrophic bacteria?

Comparative analysis of MauF proteins across methylotrophic bacteria reveals both conserved functional domains and species-specific variations that reflect evolutionary adaptations to different ecological niches:

Sequence Conservation Analysis:
MauF proteins from various methylotrophic bacteria typically share 40-70% sequence identity, with higher conservation in regions associated with cofactor binding and electron transfer. Multiple sequence alignment shows:

  • N-terminal region (residues 1-50): Highly variable, often containing species-specific signal sequences

  • Central domain (residues 51-150): Highly conserved, containing predicted cofactor binding motifs

  • C-terminal domain (residues 151-220): Moderately conserved, likely involved in protein-protein interactions

The pattern of conservation suggests that while the core electron transfer function is preserved, the regulation and specific interactions may differ between species.

Structural Predictions:
Homology modeling and structure prediction algorithms suggest that MauF adopts a fold similar to other electron transfer proteins, with potential variations in surface properties:

SpeciesPredicted Secondary StructurePredicted CofactorsSurface Charge Distribution
M. flagellatus35% α-helix, 25% β-sheet[Fe-S] clusterPredominantly negative
M. extorquens30% α-helix, 30% β-sheetHeme cMixed charged patches
M. methylotrophus40% α-helix, 20% β-sheet[Fe-S] clusterPredominantly positive

These structural differences likely influence specificity in electron transfer chain assembly and efficiency in different metabolic contexts. For example, the predominantly negative surface charge of M. flagellatus MauF may facilitate interactions with positively charged partners in its specific electron transfer chain .

What experimental approaches can resolve contradictory findings about the role of MauF in different methylotrophic bacteria?

Resolving contradictory findings about MauF's role across different methylotrophic bacteria requires a multi-faceted experimental approach that addresses both functional and evolutionary aspects:

1. Complementation Studies:

  • Cross-species complementation experiments where mauF genes from different bacteria are expressed in mauF mutants

  • Quantitative assessment of growth rates, methylamine consumption, and electron transfer activities

  • Creation of chimeric MauF proteins with domains from different species to identify functional regions

2. In vitro Reconstitution:

  • Purification of recombinant MauF proteins from multiple species

  • Assembly of homologous and heterologous electron transfer systems

  • Direct measurement of electron transfer kinetics using stopped-flow spectroscopy

  • Assessment of protein-protein interaction specificities using surface plasmon resonance

3. Advanced Structural Analysis:

  • X-ray crystallography or cryo-EM structures of MauF proteins from multiple species

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Crosslinking mass spectrometry to map interaction interfaces in different species

  • NMR studies of labeled proteins to examine conformational changes during electron transfer

4. Systems Biology Approaches:

5. Evolutionary Analysis:

  • Phylogenetic analysis of mauF genes in relation to other methylotrophy genes

  • Identification of co-evolving residues using statistical coupling analysis

  • Ancestral sequence reconstruction to test evolutionary hypotheses

A specific experimental design to resolve contradictions might include parallel characterization of recombinant MauF proteins from M. flagellatus, M. extorquens, and M. methylotrophus under identical conditions, followed by systematic analysis of electron transfer kinetics with homologous and heterologous partners. This approach would determine whether functional differences arise from intrinsic properties of MauF or from system-level adaptations in electron transport chains .

How can recombinant MauF be engineered to enhance electron transfer efficiency in synthetic methylotrophic pathways?

Engineering recombinant MauF for enhanced electron transfer efficiency in synthetic methylotrophic pathways requires targeted modifications based on structure-function relationships:

Redox Potential Optimization:
The redox potential of MauF can be fine-tuned by modifying the microenvironment of its cofactors. Mutations in the second coordination sphere of metal centers (typically 5-7Å from the cofactor) can alter redox potentials by ±50-100 mV without disrupting cofactor binding. This approach allows optimization of thermodynamic driving forces for specific synthetic pathways.

Interface Engineering:
The protein-protein interaction interfaces of MauF can be modified to enhance binding affinity and electron transfer kinetics with partner proteins. Computational design approaches such as Rosetta protein design can identify mutations that:

  • Increase complementarity at interaction surfaces

  • Optimize distances between redox centers

  • Create additional stabilizing interactions at protein-protein interfaces

Cofactor Substitution:
Alternative cofactors with different redox properties can be incorporated through:

  • Mutations that alter cofactor binding sites

  • Expression in specialized strains that produce modified cofactors

  • In vitro reconstitution with synthetic cofactors

Domain Fusion Approach:
Creating fusion proteins that covalently link MauF to its electron transfer partners can dramatically enhance electron transfer rates by:

  • Increasing the effective concentration of interaction partners

  • Ensuring proper orientation of redox centers

  • Reducing diffusion-limited steps in electron transfer

Potential Performance Improvements:
The table below summarizes predicted improvements from different engineering approaches:

Engineering ApproachExpected Improvement in Electron Transfer RateTechnical ComplexityCompatibility with Host Metabolism
Redox Potential Tuning2-5 foldModerateHigh
Interface Engineering3-10 foldHighHigh
Cofactor Substitution2-20 foldVery HighModerate
Domain Fusion10-50 foldLowModerate
Combined Approaches20-100 foldVery HighLow

These engineering strategies could significantly enhance the efficiency of synthetic methylotrophic pathways, particularly for applications in bioremediation of single-carbon compounds or production of value-added chemicals from C1 substrates .

What methodological considerations are important when using recombinant MauF as a tool to study electron transport in methylotrophic metabolism?

When using recombinant MauF as a research tool for studying electron transport in methylotrophic metabolism, several methodological considerations are critical for obtaining reliable and interpretable results:

Expression and Purification Considerations:

  • Tag position and type: The position (N- or C-terminal) and type of affinity tag can significantly affect MauF function. Ideally, compare both N- and C-terminal tagged versions to identify any functional differences.

  • Anaerobic handling: Maintain anaerobic conditions during purification if MauF contains oxygen-sensitive cofactors like iron-sulfur clusters.

  • Cofactor incorporation: Supplement expression media with relevant metal ions (Fe, Cu) and monitor cofactor incorporation spectroscopically.

Functional Assay Design:

  • Physiologically relevant electron donors/acceptors: Use natural partners (e.g., methylamine dehydrogenase) rather than artificial electron donors/acceptors when possible.

  • Temperature and pH controls: Perform assays at physiologically relevant conditions (typically pH 7.0-7.5, 30°C for M. flagellatus).

  • Anaerobic conditions: Conduct electron transfer assays in an anaerobic chamber or using oxygen-scavenging systems to prevent interference from oxygen.

System Reconstitution:

  • Component stoichiometry: Maintain physiologically relevant ratios of components in reconstituted systems.

  • Membrane mimetics: If MauF interacts with membrane components, incorporate appropriate membrane mimetics (nanodiscs, liposomes, detergent micelles).

  • Temporal resolution: Use techniques with appropriate temporal resolution for capturing electron transfer events (typically microsecond to millisecond).

Data Interpretation Challenges:

  • Distinguishing direct vs. indirect effects: Use appropriate controls to distinguish direct effects on electron transfer from indirect effects on protein stability or interactions.

  • Background activities: Account for non-specific electron transfer activities from contaminants or buffer components.

  • Cooperative effects: Consider potential allosteric or cooperative effects in multi-component systems.

Experimental Controls Table:

Control TypePurposeImplementation
Inactive MutantDistinguish specific from non-specific activitiesExpress and purify MauF with mutations in key cofactor-binding residues
System CompletenessVerify all components are necessarySystematic omission of individual components from reconstituted system
Substrate SpecificityVerify methylamine-specific effectsCompare activities with methylamine vs. other potential substrates
Oxygen SensitivityAssess impact of oxygenCompare activities under aerobic vs. strictly anaerobic conditions
Redox StateControl initial redox statesPre-reduce or pre-oxidize components before assays

By carefully addressing these methodological considerations, researchers can generate robust data about MauF's role in methylotrophic electron transport chains, enabling meaningful comparisons across different experimental conditions and between different methylotrophic bacteria .

What are the most common technical challenges when working with recombinant MauF and how can they be overcome?

Working with recombinant MauF presents several technical challenges that can significantly impact experimental outcomes. The following table identifies common issues and provides detailed troubleshooting strategies:

ChallengePossible CausesTroubleshooting Strategies
Low expression yieldCodon bias, toxicity, inclusion body formation- Optimize codon usage for expression host
- Use lower induction temperature (16-18°C)
- Try different expression hosts (E. coli Rosetta, ArcticExpress)
- Use solubility-enhancing fusion tags (SUMO, MBP)
- Consider expression in methylotrophic hosts
Poor solubilityImproper folding, hydrophobic regions, cofactor absence- Include solubilizing agents (0.1% Triton X-100, 1M urea)
- Co-express with chaperones (GroEL/ES, DnaK/J)
- Supplement growth media with cofactor precursors
- Try detergent screening for extraction
Inactive proteinImproper cofactor incorporation, oxidative damage- Purify under anaerobic conditions
- Include reducing agents (2-5 mM DTT or β-mercaptoethanol)
- Add cofactor during purification or reconstitution
- Verify correct folding using circular dichroism
Instability during storageProteolysis, aggregation, cofactor loss- Add protease inhibitors during purification
- Include 10-20% glycerol in storage buffer
- Store at -80°C in small aliquots
- Add reducing agents to prevent oxidative damage
Inconsistent activity assaysVariable cofactor content, partial denaturation- Quantify cofactor content spectroscopically
- Standardize protein:cofactor ratios
- Measure activity immediately after purification
- Include internal standards in activity assays

Advanced Problem-Solving Approach:

For particularly recalcitrant expression issues, a systematic optimization protocol is recommended:

  • Expression screening:

    • Test multiple constructs with varying N- and C-terminal boundaries

    • Screen 4-6 different expression hosts simultaneously

    • Vary induction parameters (OD600, inducer concentration, temperature, time)

  • Purification optimization:

    • Implement tandem purification using dual affinity tags

    • Use on-column refolding for proteins recovered from inclusion bodies

    • Apply size exclusion chromatography as a final polishing step

  • Activity restoration:

    • Attempt in vitro cofactor reconstitution under anaerobic conditions

    • Screen various buffer compositions for optimal activity

    • Test activity in the presence of other components of the methylamine utilization pathway

This systematic approach addresses the most common challenges encountered when working with MauF and similar electron transfer proteins from methylotrophic bacteria .

How can researchers design experiments to accurately measure electron transfer rates involving MauF in reconstituted systems?

Accurately measuring electron transfer rates involving MauF in reconstituted systems requires careful experimental design and appropriate technical approaches to capture the rapid kinetics typical of biological electron transfer:

Stopped-Flow Spectroscopy Setup:
Stopped-flow spectroscopy represents the gold standard for measuring rapid electron transfer kinetics:

  • Instrument configuration:

    • Dual-syringe setup with one syringe containing MauF and the other containing electron donor/acceptor

    • Temperature control at 30°C (optimal for M. flagellatus proteins)

    • Anaerobic chamber or oxygen-scavenging system

  • Reaction monitoring:

    • Multi-wavelength detection (350-700 nm) to track redox changes in different cofactors

    • Time resolution of 1-2 ms or better

    • Signal averaging (5-10 shots) to improve signal-to-noise ratio

  • Data analysis:

    • Global fitting to appropriate kinetic models (typically sequential electron transfer)

    • Deconvolution of multiple kinetic phases if present

    • Determination of rate constants and activation parameters

Protein Film Voltammetry Approach:
This technique provides complementary information on electron transfer thermodynamics and kinetics:

  • Electrode preparation:

    • Pyrolytic graphite edge or modified gold electrodes

    • Surface functionalization with appropriate self-assembled monolayers

    • Protein film preparation via controlled adsorption

  • Measurement conditions:

    • Buffer conditions matching physiological environment (pH 7.0-7.5)

    • Temperature control via jacketed electrochemical cell

    • Scan rates from 5-1000 mV/s to separate kinetic and thermodynamic components

  • Parameter extraction:

    • Determination of formal potentials from peak positions

    • Analysis of peak separation and height to determine electron transfer kinetics

    • Construction of Trumpet plots to extract reorganization energies

Experimental Design Considerations:

The table below outlines key experimental variables and their optimization for accurate electron transfer measurements:

VariableOptimization ApproachImpact on Measurements
Protein concentrationTitration series (1-50 μM)Higher concentrations improve signal but may promote aggregation
Ionic strengthRange test (50-500 mM NaCl)Affects protein-protein interactions and electron transfer rates
ViscosityAddition of glycerol (0-30%)Allows separation of diffusion-limited from conformational gating steps
TemperatureRange test (5-40°C)Enables determination of activation parameters
Redox mediatorsTitration of small mediatorsCan distinguish surface-accessible from buried cofactors

Data Interpretation Framework:
To extract mechanistic insights, measured electron transfer rates should be analyzed in the context of:

  • Marcus theory parameters (reorganization energy, electronic coupling)

  • Comparison with theoretical distance-dependent electron transfer models

  • Effects of site-directed mutations on rate constants

  • Correlation with structural information about cofactor arrangements

This comprehensive approach provides reliable quantitative measurements of electron transfer involving MauF, enabling meaningful comparisons across different experimental conditions and between different components of methylotrophic electron transport chains .

What are the most promising research directions for understanding the evolutionary significance of MauF in methylotrophic metabolism?

Understanding the evolutionary significance of MauF in methylotrophic metabolism presents several promising research directions that combine molecular evolution with functional studies:

Comparative Genomics and Phylogenetics:

  • Construction of comprehensive phylogenetic trees of MauF sequences across diverse bacterial phyla

  • Correlation of MauF evolution with ecological niches and carbon utilization patterns

  • Identification of horizontal gene transfer events that have shaped the distribution of mau genes

  • Analysis of selection pressures on different MauF domains to identify functionally critical regions

This approach would reveal how MauF has evolved in concert with other components of methylamine utilization pathways and identify potential adaptive modifications in different lineages .

Ancestral Sequence Reconstruction:

  • Computational reconstruction of ancestral MauF sequences at key evolutionary nodes

  • Laboratory synthesis and functional characterization of ancestral MauF proteins

  • Comparison of biochemical properties between ancestral and extant MauF variants

  • Identification of mutations that led to functional specialization or optimization

This strategy would provide direct experimental evidence about the evolutionary trajectory of MauF and reveal which modifications were critical for adaptation to specific metabolic contexts .

Experimental Evolution:

  • Laboratory evolution of methylotrophic bacteria under selective pressure

  • Tracking mutations in mauF and interacting genes during adaptation

  • Correlation of genetic changes with fitness improvements

  • Engineering predicted evolutionary intermediates to test evolutionary hypotheses

This approach would allow direct observation of adaptive processes affecting MauF under controlled conditions, potentially revealing evolutionary constraints and opportunities .

Structure-Function Studies Across Evolutionary Diverse MauF Homologs:

  • Structural determination of MauF proteins from phylogenetically diverse methylotrophs

  • Comparison of electron transfer kinetics and partner specificities

  • Identification of convergent solutions to similar functional challenges

  • Creation of chimeric proteins combining domains from evolutionary distant homologs

Such studies would connect structural features to functional properties across evolutionary time, revealing which aspects of MauF are conserved due to functional constraints and which have diversified through adaptation .

How might the study of MauF contribute to our understanding of electron transfer mechanisms in bacterial energy metabolism?

The study of MauF has significant potential to advance our fundamental understanding of electron transfer mechanisms in bacterial energy metabolism through several interconnected research avenues:

Elucidation of Specialized Electron Transfer Chains:
MauF represents a component of a specialized electron transfer system adapted for methylamine utilization. Detailed characterization of MauF can reveal:

  • How electron transfer chains are optimized for specific substrates

  • Mechanisms for preventing electron leakage in branched respiratory systems

  • Strategies for coupling electron transfer to energy conservation

  • Principles of modularity in bacterial respiratory chains

This knowledge would extend beyond methylotrophy to inform our understanding of diverse bacterial energy metabolism systems .

Probing Determinants of Redox Partner Specificity:
MauF must interact specifically with both upstream and downstream electron transfer partners. Investigating these interactions can reveal:

  • Molecular recognition principles in transient redox protein complexes

  • Mechanisms ensuring directionality in electron transfer

  • Strategies for minimizing non-productive electron transfer reactions

  • Evolution of specificity in electron transfer networks

These insights would contribute to fundamental understanding of how electron transfer specificity is achieved in biological systems .

Mechanisms of Redox Sensing and Regulation:
MauF may serve not only as an electron transfer component but potentially also as a redox sensor. Investigation of this dual role could reveal:

  • How electron transfer proteins can also function as regulatory elements

  • Mechanisms coupling redox status to gene expression

  • Strategies for metabolic adaptation to changing environmental conditions

  • Integration of electron transfer chains with cellular regulation

This research direction would bridge bioenergetics with cellular regulation, providing insights into how bacteria coordinate metabolism with environmental conditions .

Quantitative Modeling of Electron Transfer Networks:
Detailed characterization of MauF within its native context enables:

  • Development of quantitative models of complete electron transfer networks

  • Understanding of how thermodynamic and kinetic parameters are tuned for optimal function

  • Prediction of how perturbations propagate through electron transfer systems

  • Principles for rational design of synthetic electron transfer chains

Such modeling approaches would contribute to systems-level understanding of bacterial energy metabolism, with applications in synthetic biology and metabolic engineering .

The multifaceted study of MauF thus serves as a model system for understanding broader principles of biological electron transfer, connecting molecular mechanisms to cellular function and evolutionary adaptation in bacterial energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.