Recombinant Methylobacillus flagellatus Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Mfla_2444; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
mtgA
Target Protein Sequence
MIKQLFWRGLLLALVLVVLYQFWIFMHILWWVEHNPSSSAFMRASLSALQQDNPDAALKH QWVEYQRISIHLKRAVIAAEDAKFVGHEGFDWDGIQKAYEKNWKQGKIVAGGSTISQQLA KNLFLSTKRTPWRKLEEAVITWMLERMMSKRRIFEIYLNVIEWGNGVFGAEAAARHYYRT SASSLNVAQAARLAAMIPNPRYYDKHREARGLIRKARIIEARMRYAEVP
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of mtgA in Methylobacillus flagellatus?

MtgA in Methylobacillus flagellatus functions as a monofunctional biosynthetic peptidoglycan transglycosylase, playing a critical role in cell wall synthesis by polymerizing lipid II molecules into glycan strands of peptidoglycans. Unlike bifunctional penicillin-binding proteins (PBPs), mtgA focuses solely on glycosyltransferase activity without transpeptidase function. This specialization is significant for understanding peptidoglycan assembly in M. flagellatus compared to bacteria with bifunctional PBPs .

The gene encoding mtgA (Mfla_2444) has been identified through genome sequencing of M. flagellatus, an obligate methanol and methylamine utilizer belonging to the Betaproteobacteria class . The protein is classified as a member of the GT51 glycosyltransferase family, which is involved in the formation of the peptidoglycan mesh-net structure that surrounds and protects bacterial cells .

How does mtgA deletion affect bacterial cell morphology?

MtgA deletion has profound effects on bacterial cell morphology, particularly under specific growth conditions. Studies in E. coli have shown that deletion of the mtgA gene leads to significant cell enlargement, but notably, this effect is conditional:

ConditionCell Morphology EffectPolymer Accumulation
Non-polymer producingSimilar to wild-type (no significant change)Not applicable
Polymer producing1.4-fold increase in cell diameter (not length)Increased P(LA-co-3HB) production from 5.2 g/l to 7.0 g/l

The phenotype is characterized as "fat" rather than "tall" cells, as the deletion affects cell diameter but not the length of the polar axis. Complementation experiments, where the mtgA gene is reintroduced, restore normal morphology, confirming the specific role of mtgA in maintaining proper cell shape .

This morphological change correlates with increased polymer accumulation, suggesting that disruption of peptidoglycan synthesis through mtgA deletion affects cell envelope properties in a way that enhances intracellular polymer retention. This finding has potentially important applications in biotechnology .

What expression systems are optimal for recombinant mtgA production?

Several expression systems have been successfully employed for producing recombinant mtgA and related transglycosylases with high enzymatic activity:

coli Expression System:

  • For M. flagellatus mtgA, E. coli has been effectively used with N-terminal His-tagging for purification

  • Typical E. coli BL21(DE3) strains are suitable for membrane-associated proteins like mtgA

Streptomyces Expression System:

  • For related transglycosylases, Streptomyces lividans has shown excellent results

  • Using the S. lividans transformant 25-2 system, researchers achieved high-level expression of Streptomyces platensis transglutaminase with activities of 5.78 U/ml in flasks and 5.39 U/ml in 5-L fermenters

Large-Scale Production Parameters:

Large-scale production has been successfully scaled to:

  • 30-L air-lift fermenter with maximal activities of 5.36 U/ml

  • 250-L stirred-tank fermenter with activities of 2.54 U/ml

To optimize expression conditions, researchers should consider:

  • Induction parameters (temperature, inducer concentration)

  • Media composition

  • Growth phase at induction

  • Expression duration

  • Fusion tags that facilitate purification while maintaining activity

What are the optimal assay conditions for measuring mtgA activity?

Designing robust assays for mtgA transglycosylase activity requires careful consideration of substrates, reaction conditions, and detection methods:

Assay Types:

  • SDS-PAGE-based assays:

    • Utilize radiolabeled lipid II substrate

    • Separate polymerized glycan strands by SDS-PAGE

    • Quantify by densitometric analysis of bands

    • Can distinguish products containing 2-20 disaccharide units

  • HPLC-based methods:

    • Measure consumption of lipid II substrate

    • Analyze produced glycan strands by size-exclusion chromatography

  • Fluorescence-based assays:

    • Use fluorescently labeled lipid II analogues

    • Monitor polymerization through changes in fluorescence properties

Optimal Reaction Conditions:

Based on characterization of related transglycosylases, the following conditions typically yield maximum activity:

  • pH: 6.0

  • Temperature: 55°C

  • Stability range: pH 5.0-6.0 and temperature 45-55°C

  • Buffer components: Consider the effect of cations (Ca²⁺, Li⁺, Mn²⁺, Na⁺, K⁺, Mg²⁺ typically do not affect activity)

Inhibitors to Consider:

The following compounds may inhibit mtgA activity and should be accounted for in assay design:

  • Metal ions: Fe²⁺, Pb²⁺, Zn²⁺, Cu²⁺, Hg²⁺

  • Sulfhydryl reagents: PCMB, NEM

  • Serine protease inhibitors: PMSF

For membrane-associated enzymes like mtgA, reconstitution into proteoliposomes can provide a more native-like environment for activity measurements .

How should researchers design controls for mtgA deletion studies?

When studying mtgA deletion phenotypes, comprehensive controls are essential to establish causality and rule out secondary effects:

Essential Control Types:

  • Complementation Controls:

    • Express wild-type mtgA gene in the deletion strain

    • Confirm phenotype restoration (cell size normalization)

    • Use inducible promoters to demonstrate dose-dependent complementation

    • Example: In E. coli rJW, complementation with mtgA restored both cell morphology and polymer production to wild-type levels

  • Condition-Specific Controls:

    • Test phenotypes under multiple growth conditions

    • For mtgA specifically, compare polymer-producing vs. non-producing conditions

    • Measure growth rates across various media compositions

    • Example: E. coli mtgA deletion showed phenotypic changes only under polymer-producing conditions

  • Quantitative Measurements:

    • Cell dimensions (diameter, length) using calibrated microscopy

    • Polymer accumulation quantification

    • Growth kinetics (doubling time, lag phase duration)

  • Genetic Background Controls:

    • Create deletion in multiple strain backgrounds

    • Consider compensatory mutations

    • Evaluate epistatic interactions with related genes

Following the experimental design principles outlined in search result , researchers should ensure that the contrast between experimental and baseline conditions directly isolates the function of interest, avoiding what the authors term "epiphenomenal activity" that could confound results.

What is the relationship between mtgA activity and antibiotic resistance mechanisms?

The relationship between mtgA activity and antibiotic resistance involves several interconnected mechanisms:

Antibiotic Targets in Peptidoglycan Synthesis:

  • β-lactam antibiotics (penicillins, cephalosporins) target transpeptidases (PBPs)

  • Moenomycin specifically inhibits transglycosylases like mtgA

  • Vancomycin binds to lipid II, preventing both transglycosylation and transpeptidation

Mechanistic Relationships:

This functional relationship suggests that altered mtgA expression or activity could significantly impact susceptibility to cell wall-targeting antibiotics, potentially through changes in cell wall architecture or compensatory mechanisms in peptidoglycan synthesis.

How can researchers resolve contradictory findings about mtgA function across different bacterial species?

Reconciling contradictory findings about mtgA function across different bacterial species requires a systematic approach:

Phylogenetic Analysis Framework:

Research has shown that functional relationships among bacterial proteins may not always follow phylogenetic patterns. For example, methylotrophy functions in M. flagellatus were more similar to those in M. capsulatus and M. extorquens than to more closely related M. petroleiphilum species, providing evidence for polyphyletic origin of certain functions in Betaproteobacteria .

Recommended Reconciliation Approaches:

  • Comparative Studies: Conduct direct comparative studies under identical conditions across species

  • Multi-condition Testing: Analyze function across varying growth conditions and environmental contexts

  • Genetic Background Assessment: Evaluate the impact of genetic background and potential compensatory mechanisms

  • Algorithmic Analysis: Consider computational approaches like Multi-Tasking Genetic Algorithm (MTGA) to identify patterns across seemingly disparate findings

Standardized Methodology:

Develop standardized methodologies for:

  • Protein expression and purification

  • Activity assays with defined substrates

  • Phenotypic analysis of deletion mutants

  • Complementation testing

Applying this systematic framework allows researchers to determine whether contradictions reflect true biological variation or are artifacts of experimental approaches.

What are the critical experimental design parameters for studying the interaction between mtgA and other cell wall synthesis enzymes?

Studying interactions between mtgA and other cell wall synthesis enzymes requires careful experimental design:

Protein-Protein Interaction Methods:

  • Bacterial Two-Hybrid Assays: Effective for in vivo interaction detection

  • Pull-Down Assays: Using tagged mtgA to identify binding partners

  • Surface Plasmon Resonance: For quantitative binding kinetics

  • Förster Resonance Energy Transfer (FRET): For detecting interactions in live cells

Functional Interaction Assays:

  • Synergistic Activity Testing: Search result demonstrates how multiple protein-protein interactions can have synergistic effects on glycosyltransferase activity of PBP1B through interactions with its cognate lipoprotein activator LpoB and cell division protein FtsN

  • Enzyme Coupling Experiments: Test how mtgA activity affects or is affected by transpeptidases

  • Reconstitution Systems: Reconstitute multiple enzymes into proteoliposomes to study their combined activity

Genetic Interaction Analysis:

  • Synthetic Lethal Screens: Identify genes that become essential when mtgA is deleted

  • Suppressor Screens: Identify mutations that suppress mtgA deletion phenotypes

  • Epistasis Analysis: Determine the functional relationship between mtgA and other cell wall synthesis genes

Localization Studies:

  • Co-localization Analysis: Determine if mtgA co-localizes with other peptidoglycan synthesis enzymes during cell division

  • Time-Lapse Microscopy: Track dynamic interactions during cell cycle

When designing such experiments, researchers should follow the principle outlined in study that experimental and baseline conditions must be chosen to isolate the specific interaction of interest, avoiding confounding variables that might lead to misinterpretation.

What purification strategies yield highest activity for recombinant mtgA?

Optimal purification of recombinant mtgA requires balancing yield with enzymatic activity:

Multi-Step Purification Protocol:

Based on successful purification of related transglycosylases, the following strategy is recommended:

  • Initial Extraction:

    • Cell lysis in appropriate buffer

    • Centrifugation to separate membrane fraction (for membrane-associated forms)

  • Primary Purification:

    • Ammonium sulfate fractionation

    • Affinity chromatography using His-tag (for tagged recombinant mtgA)

  • Secondary Purification:

    • Ion exchange chromatography (CM-Sepharose CL-6B fast flow)

    • Blue-Sepharose fast flow chromatography

This approach has yielded approximately 33.2-fold purification with 65% yield for related enzymes .

Buffer Considerations:

  • Purification Buffer: Tris/PBS-based buffer, pH 8.0 with 6% Trehalose

  • Storage Buffer: Add glycerol to 50% final concentration for long-term storage

  • Reconstitution: Use deionized sterile water to reconstitute lyophilized protein to 0.1-1.0 mg/mL

Quality Control Parameters:

  • Activity Retention: Test enzyme activity after each purification step

  • Purity Assessment: >90% purity by SDS-PAGE

  • Stability Testing: Monitor activity over time at different storage conditions

  • Molecular Weight Verification: ~40 kDa for mtgA

Avoid repeated freeze-thaw cycles as they significantly reduce enzyme activity. For maximum stability, store aliquoted samples at -80°C .

How can researchers distinguish between the effects of mtgA deletion and secondary adaptive responses?

Distinguishing primary mtgA deletion effects from secondary adaptive responses requires carefully designed experiments:

Time-Course Analysis Approach:

  • Acute vs. Chronic Effects:

    • Implement inducible deletion systems (e.g., Cre-lox)

    • Monitor phenotypic changes immediately after induction

    • Compare with long-term adaptation in stable deletion strains

  • Transcriptomic/Proteomic Analysis:

    • Perform RNA-seq or proteomics at multiple time points after deletion

    • Identify temporally ordered changes in gene expression

    • Primary effects typically occur earlier than compensatory responses

  • Genetic Suppression Testing:

    • Screen for suppressors of mtgA deletion phenotypes

    • Characterize the mechanism of suppression

    • Suppressors often highlight compensatory pathways

Control Strategies:

  • Conditional Complementation:

    • Use titratable expression systems to restore mtgA at varying levels

    • Determine minimum expression needed to reverse phenotypes

    • Separate threshold-dependent from gradual effects

  • Domain-Specific Mutations:

    • Instead of complete deletion, introduce specific mutations that affect only certain functions

    • Compare phenotypic profiles across mutation types

  • Related Gene Deletions:

    • Delete genes in the same pathway

    • Create double/multiple deletions

    • Compare phenotypic signatures

In the E. coli study (result ), researchers effectively distinguished primary from secondary effects by:

  • Comparing polymer vs. non-polymer producing conditions

  • Using complementation to verify direct mtgA effects

  • Showing that mtgA deletion alone did not affect cell morphology under non-polymer-producing conditions

What statistical approaches are most appropriate for analyzing mtgA activity data?

Robust statistical analysis of mtgA activity data requires approaches tailored to the specific experimental design:

For Phenotypic Data:

  • Cell Morphology Comparisons:

    • Use two-way ANOVA to evaluate interactions between genotype (e.g., wild-type vs. mtgA deletion) and growth conditions

    • Implement Tukey's post-hoc test for multiple comparisons

    • Consider non-parametric alternatives when assumptions are violated

  • Polymer Production Analysis:

    • Apply ANCOVA when controlling for growth rate or biomass

    • Use regression analysis for dose-response relationships

    • Implement bootstrap methods for robust confidence intervals

Experimental Design Considerations:

  • Sample Size Determination:

    • Conduct power analysis prior to experiments

    • Ensure sufficient replication to detect biologically relevant effects

  • Randomization and Blinding:

    • Randomize sample processing order

    • Implement blinding for morphological assessments

    • Control for batch effects in multi-day experiments

  • Multiple Testing Correction:

    • Apply Bonferroni or Benjamini-Hochberg procedures when testing multiple hypotheses

    • Control family-wise error rate or false discovery rate depending on research goals

Rather than relying solely on p-values, researchers should follow principles from study to provide rigorous statistical support, including confidence intervals and effect size estimates that quantify the magnitude of observed differences.

How might CRISPR-Cas9 technology be applied to study mtgA function and regulation?

CRISPR-Cas9 technology offers powerful approaches to advance mtgA research:

Precise Genetic Manipulation:

  • Domain-Specific Mutations:

    • Target specific functional domains within mtgA

    • Create precise point mutations to investigate structure-function relationships

    • Generate truncated versions to study domain interactions

  • Regulatory Element Modification:

    • Edit promoter regions to study transcriptional regulation

    • Modify ribosome binding sites to alter translation efficiency

    • Create reporter fusions to monitor expression under different conditions

High-Throughput Approaches:

  • CRISPR Interference (CRISPRi):

    • Implement tunable repression of mtgA expression

    • Study dosage effects on cell wall synthesis and morphology

    • Combine with RNA-seq to identify compensatory pathways

  • CRISPR Activation (CRISPRa):

    • Upregulate mtgA expression

    • Investigate effects of overexpression on cell wall architecture

    • Identify potential toxic effects of excess transglycosylase activity

Systematic Interaction Mapping:

  • Pooled CRISPR Screens:

    • Identify synthetic lethal interactions with mtgA deletion

    • Discover genes that modify mtgA deletion phenotypes

    • Map the genetic interaction network of peptidoglycan synthesis

  • Base Editing Approaches:

    • Introduce specific amino acid changes without double-strand breaks

    • Create libraries of mtgA variants with subtle modifications

    • Correlate sequence variations with functional outcomes

These approaches would significantly advance our understanding of mtgA beyond traditional deletion studies, providing precise insights into structure-function relationships and regulatory mechanisms controlling peptidoglycan synthesis.

What emerging analytical technologies could enhance our understanding of mtgA-mediated peptidoglycan synthesis?

Several cutting-edge technologies show promise for advancing mtgA research:

Advanced Imaging Technologies:

  • Super-Resolution Microscopy:

    • Techniques like STORM, PALM, and SIM can achieve resolution below the diffraction limit

    • Visualize mtgA localization relative to other cell wall synthesis enzymes

    • Track dynamic changes during cell division with nanometer precision

  • Cryo-Electron Tomography:

    • Capture native conformation of mtgA within the membrane

    • Visualize peptidoglycan architecture in wild-type vs. mtgA mutants

    • Create 3D reconstructions of the cell envelope

Structural Biology Approaches:

  • Cryo-EM for Membrane Proteins:

    • Determine high-resolution structures of mtgA in different conformational states

    • Visualize substrate binding and catalytic mechanism

    • Study protein-protein interactions within peptidoglycan synthesis complexes

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map conformational dynamics of mtgA

    • Identify regions involved in protein-protein interactions

    • Study the effects of inhibitors on protein dynamics

Systems Biology Integration:

  • Multi-omics Approaches:

    • Combine transcriptomics, proteomics, and metabolomics to capture cellular responses to mtgA perturbation

    • Implement computational models of cell wall synthesis

    • Apply machine learning to identify patterns in complex datasets

  • Single-Cell Analytics:

    • Study cell-to-cell variation in mtgA expression and activity

    • Correlate mtgA function with cell cycle stages

    • Investigate heterogeneity in antibiotic responses

These technologies would provide unprecedented insights into the dynamic process of peptidoglycan synthesis, the spatial organization of synthesis machinery, and the integration of these processes with other cellular functions.

How might mtgA research contribute to novel antibiotic development strategies?

MtgA research has significant potential to inform new antibiotic development strategies:

Targeting Monofunctional Transglycosylases:

  • Novel Binding Sites:

    • Identify unique binding pockets in mtgA not present in bifunctional PBPs

    • Design selective inhibitors that specifically target monofunctional transglycosylases

    • Develop combination therapies targeting both transpeptidases and transglycosylases

  • Species-Specific Targeting:

    • Exploit structural differences between mtgA homologs across bacterial species

    • Create narrow-spectrum antibiotics with reduced resistance development

    • Target pathogens while sparing beneficial microbiota

Exploiting Deletion Phenotypes:

  • Cell Enlargement Strategy:

    • Design drugs that mimic the cell enlargement effect of mtgA deletion

    • Combine with outer membrane-disrupting agents for synergistic effects

    • Leverage the "fat cell" phenotype to increase susceptibility to other antibiotics

  • Polymer Accumulation Induction:

    • Develop compounds that induce the polymer accumulation seen in mtgA mutants

    • Create antibiotics that cause lethal accumulation of intermediates

    • Target bacteria in specific metabolic states

Resistance Management:

  • Multi-target Approach:

    • Design inhibitors that simultaneously target mtgA and other cell wall synthesis enzymes

    • Reduce resistance development through multi-target action

    • Implement cycling strategies based on different peptidoglycan synthesis targets

  • Adjuvant Development:

    • Create non-antibiotic compounds that enhance existing antibiotic efficacy by modulating mtgA activity

    • Develop agents that reverse resistance mechanisms

    • Design delivery systems that increase local concentration at the cell wall

As bacterial resistance to conventional antibiotics continues to rise, targeting understudied components of peptidoglycan synthesis like mtgA represents a promising frontier for antibiotic development, potentially leading to novel therapeutic approaches for treating resistant infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.