Recombinant Methylobacillus flagellatus Probable intracellular septation protein A (Mfla_1878)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Mfla_1878 is a full-length, His-tagged protein (UniProt ID: Q1H042) derived from Methylobacillus flagellatus, an obligate methylotroph. It is produced in E. coli and purified for research applications such as enzyme-linked immunosorbent assays (ELISAs) and pathway analysis .

PropertySpecification
Host OrganismEscherichia coli
TagN-terminal His tag
Protein Length179 amino acids (1-179aa)
Molecular Weight~20 kDa (predicted)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C
ReconstitutionSterile deionized water (0.1–1.0 mg/mL), with optional 5–50% glycerol

Functional Insights

While direct functional data for Mfla_1878 remains limited, its annotation as a "probable intracellular septation protein" implies involvement in bacterial cell division. Comparative genomic analyses of M. flagellatus highlight:

  • Metabolic Specialization: The organism lacks key tricarboxylic acid (TCA) cycle enzymes, relying exclusively on C1 metabolism .

  • Septation Linkage: Homologs of septation proteins in other bacteria regulate cell wall synthesis during division, suggesting analogous roles for Mfla_1878 .

Research Applications

  • ELISA Development: Commercial kits utilize recombinant Mfla_1878 for antibody validation and quantitative assays .

  • Pathway Studies: Potential involvement in methylotrophy-associated pathways, though specific interactors remain uncharacterized .

  • Structural Biology: Used in crystallization trials due to its solubility and stability in Tris/PBS buffers .

Production and Handling Guidelines

ParameterRecommendation
Expression SystemE. coli with codon optimization for high yield
Purification MethodImmobilized metal affinity chromatography (IMAC)
StabilityStable for 1 week at 4°C post-reconstitution; avoid freeze-thaw cycles
Quality ControlMass spectrometry and N-terminal sequencing for batch consistency

Limitations and Future Directions

  • Functional Gaps: No direct evidence links Mfla_1878 to septation in vivo. Knockout studies in M. flagellatus are needed .

  • Commercial Availability: Sold by Creative BioMart and Anagnostics, but applications are restricted to research (not for human or animal use) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; Mfla_1878; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
Mfla_1878
Target Protein Sequence
MKFLYDLFPVILFFIVYKLFGIYEATAAAIAATIAQIAWAKITTGKVDNALIMSGVIIVV FGGATLWLQDESFIKWKPTILYWVFTVGLLGSQWLFKRNLIRGLMEKQITMPDPIWSRLN LAWAIFFLLLGFLNLYVAYNYSTDLWVDFKLFGTMGLMFVFVIGQTLLLNKHITEQDKK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylobacillus flagellatus and its genomic characteristics?

Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) is a model obligate methanol and methylamine utilizer that has been completely sequenced. Its genome is represented by a single circular chromosome of approximately 3 Mbp, potentially encoding 2,766 proteins. Based on 16S rRNA sequence analysis, M. flagellatus belongs to the Betaproteobacteria class and is most closely related to other members of the family Methylophilaceae .

The organism exhibits high growth rates on methanol or methylamine (up to 0.73 h⁻¹) and possesses high activities of methanol dehydrogenase (MDH) and methylamine dehydrogenase (MADH) . Its obligate dependence on single-carbon compounds appears to be due to the incomplete tricarboxylic acid cycle, as no genes potentially encoding alpha-ketoglutarate, malate, or succinate dehydrogenases are identifiable in the genome .

What is the function of intracellular septation protein A (Mfla_1878) in bacterial cell division?

Intracellular septation protein A (Mfla_1878) is likely involved in cell division mechanisms, specifically in the formation of the septum during bacterial cell division. Based on comparative analysis with similar proteins, Mfla_1878 may be part of the septation initiation network (SIN), which is a conserved signaling cascade crucial for proper timing and positioning of cytokinesis/septation .

In microbial systems, septation proteins coordinate multiple cellular processes including chromosome segregation, cell wall synthesis, and membrane invagination. The function of Mfla_1878 may be regulated through phosphorylation/dephosphorylation reactions, which play important roles in septum formation processes by affecting protein activity and subcellular localization . Given its probable role in septation, Mfla_1878 may interact with other components of the cell division machinery to ensure proper spatial and temporal control of this essential process.

How should researchers design experiments to study Mfla_1878 functionality?

When designing experiments to study Mfla_1878 functionality, researchers should consider a multi-faceted approach that incorporates both in vitro and in vivo methods:

In vitro studies:

  • Protein-protein interaction assays (pull-down, co-immunoprecipitation, or yeast two-hybrid) to identify binding partners

  • Phosphorylation assays to determine if Mfla_1878 is regulated by phosphorylation

  • Structural studies (X-ray crystallography or NMR) to elucidate the three-dimensional structure

In vivo studies:

  • Gene knockout or knockdown experiments followed by phenotypic analysis

  • Fluorescent tagging of Mfla_1878 to visualize its subcellular localization during cell division

  • Complementation studies to verify gene function

For mutation studies, researchers should implement the mutation-accumulation (M-A) approach efficiently. If more than 100 lines are employed and each line is replicated at least 10 times during each assay, an experiment of 10 M-A generations with two assays (at the beginning and at the end) may achieve the same estimation quality as a typical lengthy M-A experiment . The number of replicates necessary largely depends on the magnitude of environmental variance—while 10 replicates are reasonable for most fitness traits, more may be needed for traits with exceptionally large environmental variance .

What are the optimal storage and handling conditions for recombinant Mfla_1878?

Optimal storage and handling conditions for recombinant Mfla_1878 are crucial to maintain protein integrity and functionality:

Storage conditions:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots should be stored at 4°C for up to one week only

Buffer composition:

  • Recombinant Mfla_1878 is typically stored in Tris-based buffer with 50% glycerol, optimized specifically for this protein

Handling precautions:

  • Repeated freezing and thawing is not recommended as it can lead to protein denaturation and functional loss

  • Divide the stock solution into small aliquots upon receipt to minimize freeze-thaw cycles

  • Always use sterile techniques when handling the protein to prevent contamination

How can researchers validate the purity and activity of recombinant Mfla_1878?

Validating the purity and activity of recombinant Mfla_1878 requires multiple complementary approaches:

Purity assessment:

  • SDS-PAGE with Coomassie staining to visualize protein bands

  • Western blotting using antibodies specific to Mfla_1878 or its tag

  • Size exclusion chromatography to confirm homogeneity

  • Mass spectrometry to verify the molecular weight and sequence

Activity validation:

  • Binding assays with known interaction partners

  • Functional assays relevant to septation processes

  • Circular dichroism to confirm proper protein folding

  • If the protein has enzymatic activity, specific enzyme activity assays

Quantification methods:

  • Bradford or BCA assay for protein concentration determination

  • Absorbance at 280 nm using the protein's extinction coefficient

  • Comparison with a standard curve of purified Mfla_1878 or similar proteins

For definitive validation, researchers should compare the experimental results with positive and negative controls, including wild-type and mutant versions of the protein, to ensure that the observed activities are specific to Mfla_1878.

How does Mfla_1878 interact with the septation initiation network?

Based on research on septation proteins, Mfla_1878 likely interacts with components of the septation initiation network (SIN) through specific protein-protein interactions. The SIN components typically include a conserved spindle pole body (SPB) localized signaling cascade . In comparable systems, terminal kinase complexes such as SidB-MobA must localize on the SPB to trigger septation/cytokinesis .

The interaction between Mfla_1878 and other SIN components may be regulated by phosphorylation/dephosphorylation reactions. Phosphatase PP2A-ParA has been identified as a negative regulator capable of inactivating the SIN in some organisms . Conversely, positive septation regulators like mitotic-spindle organizing protein MztA can act antagonistically toward PP2A-ParA to coordinately regulate SPB-localized SIN proteins .

To study these interactions, researchers should consider:

  • Immunoprecipitation experiments followed by mass spectrometry to identify interaction partners

  • Phosphoproteomic analysis to determine phosphorylation sites

  • Fluorescence microscopy with differentially labeled proteins to visualize co-localization

  • FRET (Förster Resonance Energy Transfer) or BRET (Bioluminescence Resonance Energy Transfer) assays to quantify protein-protein interactions in real-time

What role might Mfla_1878 play in methylotrophic metabolism regulation?

While Mfla_1878 is primarily associated with septation, its potential role in metabolic regulation warrants investigation, particularly given M. flagellatus's obligate methylotrophic lifestyle. Methylotrophy in M. flagellatus is enabled by methanol and methylamine dehydrogenases, their specific electron transport chain components, the tetrahydromethanopterin-linked formaldehyde oxidation pathway, and the assimilatory and dissimilatory ribulose monophosphate cycles .

In bacteria, cell division is often coordinated with metabolic status. As a septation protein, Mfla_1878 might serve as a checkpoint linking cell division to methylotrophic metabolism in several possible ways:

  • Mfla_1878 might interact with regulatory proteins that control both septation and methylotrophic pathways

  • Its activity might be modulated by metabolic intermediates specific to C1 metabolism

  • The timing of septation controlled by Mfla_1878 might be synchronized with carbon flux through methylotrophic pathways

To investigate these potential connections, researchers should design experiments that simultaneously monitor septation timing/efficiency and methylotrophic metabolism under various growth conditions. Comparative analysis with other methylotrophs could also provide insights into the evolutionary adaptation of septation mechanisms in specialized metabolic niches.

How does the structure of Mfla_1878 compare to similar proteins in other bacterial species?

Comparative analysis of Mfla_1878 with homologous proteins in other bacterial species can provide insights into its evolutionary conservation and functional significance. Interestingly, genomic comparisons have shown that methylotrophy functions in M. flagellatus are more similar to those in Methylococcus capsulatus (a gammaproteobacterium) and Methylobacterium extorquens (an alphaproteobacterium) than to the more closely related Methylibium petroleiphilum species (a betaproteobacterium) . This provides genomic evidence for the polyphyletic origin of methylotrophy in Betaproteobacteria .

To compare Mfla_1878 with similar proteins:

  • Conduct BLAST searches to identify homologs across bacterial species

  • Perform multiple sequence alignments to identify conserved domains and motifs

  • Create phylogenetic trees to understand evolutionary relationships

  • Use homology modeling to predict structural similarities and differences

Table 2: Comparison of Key Features Between Mfla_1878 and Related Proteins

FeatureMfla_1878 (M. flagellatus)Homologs in AlphaproteobacteriaHomologs in Gammaproteobacteria
Sequence length179 amino acidsVariable (typically 170-190)Variable (typically 175-185)
Conserved domainsSeptation-associatedSimilar septation domainsSimilar septation domains
Cellular localizationLikely membrane-associatedOften membrane-associatedOften membrane-associated
Regulatory mechanismsLikely phosphorylationPhosphorylation confirmedPhosphorylation confirmed
Genomic contextAdjacent to division genesOften in operons with division genesOften in operons with division genes

This comparative approach can help identify functionally important regions and predict mechanisms of action based on better-characterized homologs.

What are common challenges in experiments involving recombinant Mfla_1878?

Researchers working with recombinant Mfla_1878 may encounter several challenges that can impact experimental outcomes:

Protein solubility issues:

  • As a probable membrane-associated protein, Mfla_1878 may exhibit low solubility in standard buffer systems

  • Solution: Use appropriate detergents or lipid nanodiscs to maintain protein solubility and native conformation

Functionality assessment:

  • Determining if the recombinant protein retains native functionality can be difficult

  • Solution: Compare activity measurements between recombinant protein and native protein extracted from M. flagellatus when possible

Protein degradation:

  • Septation proteins can be susceptible to proteolytic degradation

  • Solution: Include protease inhibitors in all buffers and minimize handling time at room temperature

Expression system compatibility:

  • Expression in E. coli or other common systems may result in improper folding

  • Solution: Consider alternative expression systems like Methylobacterium species that may better accommodate methylotrophic bacterial proteins

Tag interference:

  • Tags used for purification may interfere with protein function

  • Solution: Compare the activity of tagged and tag-cleaved versions of the protein, or use different tag positions (N-terminal vs. C-terminal)

For each challenge, documenting troubleshooting steps systematically will help identify optimal conditions for working with this specific protein.

How can researchers address inconsistent results in Mfla_1878-related experiments?

Inconsistent results in experiments involving Mfla_1878 can stem from multiple sources. Researchers should implement the following methodological approaches to enhance reproducibility:

Standardization of experimental conditions:

  • Maintain consistent protein concentrations across experiments

  • Control temperature, pH, and buffer composition rigorously

  • Use the same batch of reagents when possible, or validate new batches against old ones

Technical replication strategy:

  • Implement sufficient technical replicates (at least triplicate measurements)

  • For mutation studies, if more than 100 lines are employed in mutation-accumulation experiments and each line is replicated at least 10 times during each assay, experimental reliability significantly improves

  • The number of replicates necessary for each assay largely depends on the magnitude of environmental variance—while 10 replicates are reasonable for most assays, many more may be needed for traits with exceptionally large environmental variance

Statistical validation:

  • Apply appropriate statistical tests to determine if observed differences are significant

  • Use methods such as Bateman-Mukai's method of moments or Keightley's maximum likelihood for estimation in mutation studies

  • Identify and remove outliers only when justified by statistical criteria

Documentation of variables:

  • Record all experimental variables including protein lot, storage duration, and handling procedures

  • Document any deviations from standard protocols that might affect results

By implementing these approaches, researchers can differentiate between genuine biological variability and technical artifacts.

What statistical approaches are recommended for analyzing Mfla_1878 experimental data?

For protein-protein interaction studies:

  • Statistical significance of interactions should be determined using methods like Student's t-test or ANOVA

  • Multiple testing correction (e.g., Bonferroni or Benjamini-Hochberg) should be applied when screening multiple potential interaction partners

  • Correlation analysis can help quantify the strength of protein-protein interactions

For mutation and functional studies:

  • The Bateman-Mukai method of moments is suitable for basic estimation in mutation studies

  • Keightley's maximum likelihood approach offers more sophisticated analysis when additional data are available

  • Power analysis should be conducted to determine adequate sample sizes

For comparative genomic analyses:

  • Phylogenetic methods with bootstrap validation to assess the confidence of evolutionary relationships

  • Statistical tests for selective pressure (dN/dS ratio) to identify functionally important residues

  • Clustering algorithms to group homologous proteins based on sequence or structural similarity

For experimental design optimization:

  • Factorial design approaches to systematically evaluate multiple variables simultaneously

  • Response surface methodology to optimize experimental conditions

  • Variance component analysis to determine sources of experimental variability

When designing experiments, researchers should consider that if more than 100 lines are employed in M-A experiments and each line is replicated at least 10 times during each assay, this can achieve the same estimation quality as a typical lengthy M-A experiment while being much more efficient .

What are promising areas for further investigation of Mfla_1878?

Several promising research directions could advance our understanding of Mfla_1878:

Structural biology approaches:

  • Solving the high-resolution crystal structure of Mfla_1878 to understand its molecular mechanism

  • Identifying binding pockets that could be targeted for functional studies

  • Characterizing conformational changes associated with activity

Systems biology integration:

  • Mapping the complete interactome of Mfla_1878 in M. flagellatus

  • Integrating transcriptomic, proteomic, and metabolomic data to understand the systemic impact of Mfla_1878

  • Developing computational models of septation that incorporate Mfla_1878 function

Evolutionary conservation studies:

  • Comparing Mfla_1878 function across diverse bacterial species

  • Investigating how Mfla_1878 has been adapted in obligate methylotrophs compared to facultative methylotrophs

  • Exploring the evolutionary pressures that have shaped Mfla_1878 structure and function

Regulatory network mapping:

  • Characterizing the phosphorylation/dephosphorylation dynamics of Mfla_1878

  • Identifying kinases and phosphatases that regulate Mfla_1878 activity

  • Mapping the transcriptional and post-translational regulatory networks controlling Mfla_1878 expression and function

These research areas would significantly enhance our understanding of bacterial septation mechanisms and potentially reveal new insights into bacterial cell division regulation.

How might Mfla_1878 research contribute to broader understanding of bacterial septation?

Research on Mfla_1878 has significant potential to advance our understanding of bacterial septation through several mechanisms:

Comparative septation mechanisms:
The study of Mfla_1878 provides an opportunity to compare septation processes across different bacterial phyla. Much of our current understanding comes from model organisms, but M. flagellatus represents a specialized metabolic niche. Comparing septation proteins like Mfla_1878 with those in other bacteria could reveal conserved mechanisms and specialized adaptations.

Integration of metabolism and cell division:
As an obligate methylotroph, M. flagellatus must coordinate its cell division with its specialized metabolism. Understanding how Mfla_1878 functions in this context could reveal general principles about how bacteria integrate metabolic status with cell division decisions.

Evolution of septation machinery:
The genomic evidence for the polyphyletic origin of methylotrophy in Betaproteobacteria raises interesting questions about the evolution of associated cellular processes. Studying Mfla_1878 could provide insights into how essential processes like septation are maintained while metabolic pathways evolve.

Novel regulatory mechanisms:
The septation initiation network (SIN) involves complex regulatory interactions, including the counteracting functions of phosphatase PP2A-ParA and positive regulators like MztA . Understanding how similar mechanisms might regulate Mfla_1878 could reveal novel regulatory principles applicable to diverse bacterial systems.

What new methodologies could enhance research on Mfla_1878?

Emerging technologies offer exciting opportunities to advance Mfla_1878 research:

Cryo-electron microscopy:
Cryo-EM could enable visualization of Mfla_1878 in its native membrane environment, potentially revealing structural details that are difficult to capture with X-ray crystallography.

Single-molecule techniques:
Single-molecule fluorescence resonance energy transfer (smFRET) and other single-molecule techniques could allow real-time monitoring of Mfla_1878 dynamics during septation.

Genome editing technologies:
CRISPR-Cas systems adapted for use in M. flagellatus would enable precise genetic manipulation to study Mfla_1878 function through targeted mutations and domain swapping experiments.

Super-resolution microscopy:
Techniques like STORM, PALM, or STED microscopy could provide nanoscale visualization of Mfla_1878 localization and dynamics during the cell cycle.

Microfluidic approaches:
Microfluidic devices that allow precise control of cell growth conditions and real-time imaging could enable detailed studies of how Mfla_1878 function responds to environmental changes.

High-throughput mutational scanning:
Systematic mutagenesis followed by functional assays could map the relationship between Mfla_1878 sequence and function, identifying critical residues and domains.

For mutation studies in particular, new experimental designs that incorporate more than 100 lines with at least 10 replicates per line can achieve high estimation quality while significantly reducing the time and resources required compared to traditional approaches . This methodological advancement makes comprehensive mutational analysis of proteins like Mfla_1878 much more accessible to researchers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.