Recombinant Methylobacillus flagellatus Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
crcB; Mfla_1221; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
crcB
Target Protein Sequence
MYQVMLVALGGAIGSAARFTLSGLVLRYSLDWRFPLPTFTVNIIGCLVIGMLAGLASKEG FISPDMRVLLFTGLVGGFTTFSAFGLETLVLLREGLVGIAAAYIVSSIVVGLVLMWLGFE LVKMTMQA
Uniprot No.

Target Background

Function
CrcB plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional characterization of CrcB homolog in Methylobacillus flagellatus?

The CrcB homolog in Methylobacillus flagellatus is characterized as a membrane protein involved in cellular resistance mechanisms. Based on comparative analysis with similar proteins like the CrcB homolog in other bacterial species, it likely consists of approximately 130-140 amino acids, forming multiple transmembrane domains. Functionally, CrcB homologs are primarily associated with camphor resistance and fluoride ion channel activity, serving as a protective mechanism against environmental toxins .

The protein structure analysis should be approached through methods such as X-ray crystallography or cryo-electron microscopy, with prior optimization of expression and purification conditions specifically for membrane proteins. For characterizing transmembrane topology, techniques like PhoA fusion analysis or cysteine accessibility methods are recommended.

What expression systems are optimal for recombinant production of Methylobacillus flagellatus CrcB homolog?

For recombinant expression of Methylobacillus flagellatus CrcB homolog, researchers should implement a systematic evaluation of expression systems. E. coli-based systems (particularly BL21(DE3) or Rosetta strains) with inducible promoters like T7 are recommended for initial screening, as they provide rapid growth and high protein yields. For membrane proteins like CrcB homolog, consider the following optimization strategy:

  • Test multiple expression vectors with different fusion tags (His, GST, MBP)

  • Evaluate expression at reduced temperatures (16-25°C) to enhance proper folding

  • Optimize induction conditions (IPTG concentration, induction timing)

  • Consider specialized expression hosts for membrane proteins such as C41/C43 (DE3)

Expression systems similar to those used for recombinant production of Methylobacillus flagellatus Recombination protein RecR may serve as a useful reference point .

What purification strategies yield high-purity CrcB homolog suitable for structural and functional studies?

Purification of membrane proteins like CrcB homolog requires specialized approaches to maintain protein integrity and function. Implement this multi-step strategy:

  • Membrane extraction: Use mild detergents (DDM, LDAO, or Fos-choline) for initial solubilization

  • Affinity chromatography: Utilize His-tag or other fusion tags for initial capture

  • Ion exchange chromatography: Further purify based on CrcB's predicted isoelectric point

  • Size exclusion chromatography: Final polishing step to remove aggregates and achieve monodisperse protein

The table below summarizes recommended detergent conditions for CrcB homolog purification:

DetergentWorking ConcentrationAdvantagesLimitations
DDM0.05-0.1%Gentle, maintains functionLarge micelles
LDAO0.1-0.5%Smaller micellesMay destabilize some proteins
Fos-choline-120.05-0.1%Effective solubilizationPotentially destabilizing
Digitonin0.1-0.5%Natural, very mildExpensive, variable purity

Purity assessment should employ multiple methods including SDS-PAGE, Western blotting, and mass spectrometry to confirm protein identity and homogeneity.

How can regulatory networks of CrcB homolog be investigated using transcriptomic approaches?

Investigating regulatory networks of the CrcB homolog in Methylobacillus flagellatus requires a comprehensive transcriptomic approach. Based on similar studies with the CrcB homolog in related systems, we can implement the following methodology:

  • RNA-seq analysis: Compare expression profiles under various conditions (different carbon sources, stress conditions, growth phases)

  • Promoter analysis: Identify potential transcription factor binding sites in the crcB promoter region

  • ChIP-seq: Determine which transcription factors bind to the crcB promoter in vivo

  • Network analysis: Construct co-expression networks to identify genes with similar expression patterns

From comparative data available for CrcB homologs in other organisms, it has been observed that the protein is often co-regulated with genes involved in carbohydrate metabolism and stress response pathways. For instance, the CrcB homolog in related systems is predicted to be co-regulated in specific modules with residuals of 0.48 and 0.52, suggesting involvement in defined regulatory networks .

What bioinformatic approaches can resolve inconsistencies in CrcB homolog sequence and functional predictions?

Resolving inconsistencies in CrcB homolog sequence and functional predictions requires a multi-layered bioinformatic approach that can detect and reconcile contradictions in existing data. Implement the following methodology:

  • Multiple sequence alignment: Align CrcB sequences from diverse bacterial species to identify conserved regions and potential annotation errors

  • Phylogenetic analysis: Construct maximum likelihood trees to clarify evolutionary relationships

  • Domain prediction: Utilize multiple tools (Pfam, InterPro, SMART) to achieve consensus on functional domains

  • Structural modeling: Generate 3D models using AlphaFold2 or similar tools to predict functional sites

  • Inconsistency detection algorithms: Apply specialized tools similar to those used in financial report contradiction detection to identify inconsistencies between different database entries

When contradictions are identified between different database annotations or functional predictions, implement a weighted consensus approach that prioritizes experimentally validated data over computational predictions. Document all inconsistencies systematically to contribute to improved annotation of these proteins in public databases.

How should experimental designs be structured to study phenotypic effects of CrcB homolog mutations?

When designing experiments to study the phenotypic effects of CrcB homolog mutations in Methylobacillus flagellatus, a Randomized Complete Block Design (RCBD) approach is recommended. This design effectively controls for nuisance factors that could introduce systematic variation and confound results .

Implementation steps:

  • Identify blocking factors: Common blocking factors include batch effects, growth conditions, and laboratory-specific variables

  • Randomize within blocks: Assign treatment combinations (different mutations) randomly within each block

  • Include complete treatments: Ensure each mutation variant is tested in every block

  • Control for environmental variables: Standardize temperature, media composition, and growth phase

The RCBD approach is particularly valuable as it reduces experimental error by controlling systematic sources of variation, thereby increasing experimental precision . This is crucial when studying subtle phenotypic changes that may result from CrcB homolog mutations.

Example experimental design:

Block (Time Point)Treatment 1 (Wild-type)Treatment 2 (Mutation A)Treatment 3 (Mutation B)Treatment 4 (Mutation C)
Block 1 (Day 1)Cell 1,1Cell 1,2Cell 1,3Cell 1,4
Block 2 (Day 2)Cell 2,1Cell 2,2Cell 2,3Cell 2,4
Block 3 (Day 3)Cell 3,1Cell 3,2Cell 3,3Cell 3,4

What computational approaches can identify contradictions in experimental data on CrcB homolog function?

Identifying contradictions in experimental data regarding CrcB homolog function requires robust computational approaches. Drawing from methodologies used in financial report contradiction detection , researchers can implement the following strategy:

  • Text mining of research literature: Apply natural language processing techniques to extract claims about CrcB function from published literature

  • Semantic representation: Convert experimental findings into structured representations that can be computationally compared

  • Contradiction detection algorithms: Implement specialized algorithms that can identify logical inconsistencies between different experimental results

  • Clustering of related findings: Group similar experimental results to identify outliers and potential contradictions

  • Large language model analysis: Utilize LLMs specifically fine-tuned for scientific literature to identify subtle contradictions that might be missed by traditional methods

When contradictions are identified, researchers should systematically evaluate the experimental conditions, methodologies, and statistical approaches used in each study to determine the source of discrepancies. This process should be documented in a standardized format to facilitate meta-analysis and consensus building in the field.

How can heterogeneous data types be integrated to elucidate CrcB homolog functions across different organisms?

Integrating heterogeneous data types to understand CrcB homolog functions across different organisms requires a multi-omics approach:

  • Data collection and standardization:

    • Genomic data: Sequence and structural annotations

    • Transcriptomic data: Expression profiles under various conditions

    • Proteomic data: Interaction networks and post-translational modifications

    • Phenotypic data: Growth characteristics and stress responses

  • Integration framework:

    • Implement network-based integration methods that can handle different data types

    • Use dimensionality reduction techniques to visualize relationships across datasets

    • Apply machine learning approaches to predict functional relationships

  • Comparative analysis across organisms:

    • Create orthology maps to track CrcB homologs across species

    • Identify conserved and divergent features in sequence, structure, and regulation

    • Correlate functional differences with ecological niches and evolutionary history

Based on available data for CrcB homologs in other organisms, these proteins appear to be involved in specific modules with defined regulatory patterns, suggesting conserved functional roles across bacterial species .

What fluorescence-based assays can quantify CrcB homolog ion transport activity in reconstituted systems?

For quantifying the ion transport activity of CrcB homolog (particularly its putative role in fluoride transport), fluorescence-based assays in reconstituted systems offer high sensitivity and temporal resolution. Implement the following methodology:

  • Liposome reconstitution:

    • Prepare unilamellar liposomes (100-200 nm) using E. coli polar lipids or synthetic mixtures

    • Incorporate purified CrcB homolog using detergent-mediated reconstitution

    • Load liposomes with ion-sensitive fluorescent dyes

  • Fluorescence-based ion flux assays:

    • For fluoride transport: Use PBFI (potassium-binding benzofuran isophthalate) with a counterion gradient

    • For pH-dependent studies: Incorporate BCECF (2',7'-Bis-(2-Carboxyethyl)-5-(and-6)-Carboxyfluorescein)

    • Monitor fluorescence changes using stopped-flow spectrofluorometry

  • Data analysis:

    • Calculate initial rates of transport under varying conditions

    • Determine kinetic parameters (Km, Vmax) for ion transport

    • Compare wild-type with mutant variants to identify key residues

This approach allows for precise quantification of transport activity under controlled conditions, enabling detailed structure-function analysis of the CrcB homolog.

How can CRISPR-Cas9 be optimized for generating CrcB homolog knockouts in Methylobacillus flagellatus?

Developing CRISPR-Cas9 systems for Methylobacillus flagellatus requires careful optimization due to potential species-specific barriers. The following methodology addresses these challenges:

  • Vector system design:

    • Select appropriate promoters for Cas9 and gRNA expression in Methylobacillus flagellatus

    • Design temperature-optimized Cas9 variants if standard enzymes show low activity

    • Incorporate selectable markers compatible with this organism

  • gRNA design for CrcB homolog targeting:

    • Analyze the CrcB homolog sequence for optimal CRISPR target sites

    • Avoid targets with off-target matches elsewhere in the genome

    • Design multiple gRNAs targeting different regions of the gene

  • Delivery optimization:

    • Test multiple transformation methods (electroporation, conjugation)

    • Optimize transformation conditions (buffer composition, field strength)

    • Evaluate different recovery media compositions

  • Knockout verification:

    • PCR-based genotyping of transformants

    • Whole-genome sequencing to confirm on-target editing and exclude off-target effects

    • RT-qPCR and Western blotting to confirm absence of CrcB homolog expression

Applying a systematic optimization approach similar to experimental design principles used in RCBD will maximize the efficiency of generating viable CrcB homolog knockout strains.

How does the Methylobacillus flagellatus CrcB homolog compare structurally and functionally to homologs in other bacterial species?

Comparative analysis of CrcB homologs across bacterial species reveals important insights into structure-function relationships. Based on data from related proteins such as the CrcB homolog in Mycobacterium tuberculosis (Rv3069) , we can draw the following comparisons:

  • Sequence conservation:

    • Core transmembrane domains show high conservation (>60% similarity)

    • N-terminal and C-terminal regions display greater variability

    • Key functional residues for ion selectivity are typically conserved

  • Structural features:

    • Most CrcB homologs contain 3-4 transmembrane helices

    • The Mycobacterium tuberculosis CrcB homolog 1 (Rv3069) consists of 132 amino acids , which is similar to the expected length of the Methylobacillus flagellatus homolog

    • Conserved structural motifs are present despite sequence divergence

  • Functional conservation:

    • Primary function as fluoride channels appears conserved across species

    • Secondary functions may vary based on ecological niche

    • Regulatory contexts differ significantly between species

The Mycobacterium tuberculosis CrcB homolog is associated with enriched GO terms related to carbohydrate metabolic processes and transferase activity , suggesting potential functional conservation with the Methylobacillus flagellatus homolog. Additionally, the observed co-regulation patterns in specific modules (bicluster_0256 and bicluster_0471) may indicate similar regulatory networks across species .

What evolutionary patterns explain the distribution and diversification of CrcB homolog across bacterial phyla?

The evolutionary history of CrcB homologs across bacterial phyla reveals important patterns about functional adaptation and horizontal gene transfer. A comprehensive analysis should include:

  • Phylogenetic reconstruction:

    • Construct maximum likelihood trees using aligned CrcB sequences

    • Map the distribution across the bacterial tree of life

    • Identify potential horizontal gene transfer events

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Compare selection pressures across different bacterial lineages

    • Correlate selection patterns with ecological niches

  • Gene neighborhood analysis:

    • Examine conservation of genomic context around CrcB homologs

    • Identify co-evolved gene clusters that may indicate functional relationships

    • Track operon structure changes across evolutionary time

Based on patterns observed in other membrane channels, CrcB homologs likely represent an ancient protein family that has diversified to handle specific environmental challenges across different bacterial phyla. The association with camphor resistance and other metabolic functions suggests adaptive evolution in response to specific ecological pressures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.