Recombinant Methylobacillus flagellatus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Role of UPP Phosphatases in Bacterial Metabolism

Undecaprenyl pyrophosphate (UPP) is a critical lipid carrier in bacterial cell envelope synthesis, shuttling precursors for peptidoglycan and wall teichoic acid biosynthesis. UPP phosphatases convert UPP to Und-P (undecaprenyl monophosphate), a substrate for glycosyltransferases. In Bacillus subtilis, UppP and BcrC are functionally redundant UPP phosphatases essential for viability . Depletion of these enzymes disrupts cell wall synthesis, activates envelope stress responses (e.g., σᴹ regulon), and induces morphological defects .

EnzymeOrganismFunctionViabilityStress Response
UppPB. subtilisConverts UPP → Und-PEssentialσᴹ activation
BcrCB. subtilisRedundant to UppPEssentialσᴹ activation

Hypothetical Function of Recombinant uppP in M. flagellatus

If M. flagellatus possesses a homolog of uppP, its role would likely mirror that in other Gram-positive bacteria:

  1. Cell Wall Biosynthesis: Recycling UPP to Und-P for peptidoglycan synthesis.

  2. Stress Response: Activation of σᴹ-dependent pathways under envelope stress (e.g., antibiotic exposure) .

  3. Antibiotic Target: UPP phosphatases are critical for cell wall synthesis, making them potential targets for novel antimicrobials .

Research Gaps and Future Directions

The absence of direct data on uppP in M. flagellatus highlights critical gaps:

  • Genomic Annotation: No evidence of uppP homologs in M. flagellatus genome analyses .

  • Functional Studies: No mutants or biochemical assays for UPP phosphatases in M. flagellatus are reported.

  • Recombinant Production: Recombinant expression systems for bacterial UPP phosphatases (e.g., B. subtilis UppP) exist , but none are documented for M. flagellatus.

Broader Implications for Methylotrophs

M. flagellatus’s metabolic specialization on C₁ compounds (e.g., methanol) may impose unique demands on cell envelope synthesis. For example:

  • Redundant Pathways: The organism encodes multiple formaldehyde oxidation pathways (e.g., cyclic vs. linear) , suggesting a capacity to adapt to metabolic stress.

  • Antibiotic Synergy: Inhibitors targeting UPP phosphatases (e.g., bacitracin) could synergize with β-lactams or vancomycin in other species , but efficacy in M. flagellatus remains untested.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses and avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag type.
Synonyms
uppP; Mfla_2527; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
uppP
Target Protein Sequence
MDILLLLKAFILGIIEGATEFLPISSTGHLIIVGDLLDFNDDKGKVFEIVIQLGAILAVC WEYRSRLISVATTLHTNTSQRFILNLFVAFLPAAIFGLLLHGFIKEHLFSSITVACALIV GGFAILLVENLYAHDKAPAAKASNLNEITPWQALKVGCAQSLAIMPGVSRSGATILGGMI FGLNRKTATEFSFFLAIPVMLAATFYDVYKNFSLFVFEDLAMFAVGFITAFLAALVAIKT LIRYVANHDFKGFAYYRIVLGIIVLAYYW
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its function in bacterial cells?

Undecaprenyl-diphosphatase (EC 3.6.1.27), encoded by the uppP gene, is a critical enzyme involved in bacterial cell envelope synthesis. This enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to generate undecaprenyl monophosphate (Und-P), which serves as an essential lipid carrier for cell wall precursors. In bacterial physiology, Und-P functions as a carrier molecule that transports peptidoglycan and wall teichoic acid precursors across the cytoplasmic membrane during cell envelope biosynthesis. The conversion between the pyrophosphate and monophosphate forms is crucial for maintaining the lipid carrier cycle and ensuring proper cell wall synthesis .

In organisms like Bacillus subtilis, UPP phosphatases are essential for viability, as they maintain the integrity of the bacterial cell envelope against turgor pressure and environmental stresses. Depletion of UPP phosphatase activity leads to significant morphological defects consistent with failure of cell envelope synthesis and strongly activates stress response pathways .

What experimental approaches are used to characterize uppP functional properties?

Characterizing the functional properties of uppP typically involves a multi-faceted approach combining biochemical assays, genetic manipulation, and structural biology techniques. The primary methods include:

  • Enzymatic activity assays: Researchers use spectrophotometric or radioisotope-based assays to measure the dephosphorylation of UPP to Und-P, often quantifying either the released inorganic phosphate or the conversion rate of the substrate.

  • Site-directed mutagenesis: By introducing specific mutations into the uppP gene, researchers can identify critical residues for catalysis, substrate binding, or protein stability. In particular, mutations in the predicted active site or transmembrane domains provide insights into the enzyme's mechanism.

  • Membrane reconstitution studies: Since uppP is a membrane protein, reconstituting the purified enzyme in liposomes or nanodiscs allows for studying its activity in a controlled lipid environment that mimics the native membrane.

  • Structural analysis: Techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy can reveal the three-dimensional structure of uppP, though these approaches are challenging for membrane proteins.

  • Genetic complementation assays: In systems like B. subtilis where UPP phosphatases are essential, the functional significance of M. flagellatus uppP can be assessed through its ability to complement UPP phosphatase-deficient strains .

What are the recommended protocols for expressing and purifying recombinant M. flagellatus uppP?

The expression and purification of recombinant Methylobacillus flagellatus uppP require specialized techniques due to its nature as a membrane-associated enzyme. Based on established protocols for similar proteins, the following methodology is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3): These strains are optimized for membrane protein expression

  • Expression vectors: pET or pBAD series with appropriate fusion tags (His6, MBP, or SUMO) to aid solubility and purification

  • Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations minimize aggregation

Purification Protocol:

  • Cell lysis: Mechanical disruption (French press or sonication) in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol

  • Membrane isolation: Ultracentrifugation at 100,000×g to separate membranes

  • Solubilization: Gentle detergents (DDM, LMNG, or CHAPS) at 1-2% for initial extraction, reduced to 0.05-0.1% for subsequent steps

  • Affinity chromatography: Ni-NTA for His-tagged proteins

  • Size exclusion chromatography: Final purification and buffer exchange to storage buffer (Tris-based buffer with 50% glycerol)

Storage Recommendations:

  • Store at -20°C for short-term or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

How can researchers design experiments to analyze uppP activity in relation to bacterial cell wall synthesis?

Designing experiments to analyze uppP activity in relation to bacterial cell wall synthesis requires a multidisciplinary approach combining genetics, biochemistry, and microscopy. Consider the following experimental framework:

Genetic Approaches:

  • Depletion studies: Implementing an optimized CRISPR interference (CRISPRi) system with dCas9-based transcriptional repression to gradually deplete uppP expression and observe effects on cell viability and morphology .

  • Complementation assays: Testing whether M. flagellatus uppP can restore viability in strains depleted of endogenous UPP phosphatases.

  • Gene knockout/knockdown: Where viable, creating conditional mutants to study uppP essentiality.

Biochemical Analyses:

  • Cell wall precursor accumulation: Measuring the buildup of cell wall precursors when uppP activity is inhibited.

  • Lipid carrier cycle analysis: Quantifying the relative amounts of UPP versus Und-P under different conditions.

  • Pulse-chase experiments: Using radiolabeled precursors to track cell wall synthesis rates with varying levels of uppP activity.

Morphological Observations:

  • Electron microscopy: Examining ultrastructural changes in the cell envelope when uppP is depleted.

  • Fluorescence microscopy: Using fluorescent D-amino acids or other cell wall probes to visualize synthesis patterns.

Stress Response Analysis:

  • Transcriptomics/proteomics: Measuring activation of cell envelope stress responses (like σM in B. subtilis) when uppP activity is compromised .

  • Antibiotic susceptibility testing: Determining changes in sensitivity to cell wall-targeting antibiotics.

What methods are effective for studying the interaction between uppP and potential inhibitors?

Studying interactions between uppP and potential inhibitors requires techniques that can detect and characterize binding events and inhibitory effects. The following methodological approaches are recommended:

Binding Assays:

  • Thermal shift assays: Measuring changes in protein thermal stability upon inhibitor binding

  • Surface plasmon resonance (SPR): Quantifying binding kinetics in real-time

  • Isothermal titration calorimetry (ITC): Determining thermodynamic parameters of binding

  • Microscale thermophoresis (MST): Detecting binding through changes in thermophoretic mobility

Enzymatic Inhibition Studies:

  • IC50 determination: Testing inhibitor concentration series to determine half-maximal inhibitory concentration

  • Kinetic inhibition models: Analyzing Lineweaver-Burk or other plots to determine inhibition mechanisms (competitive, non-competitive, uncompetitive)

  • Time-dependent inhibition: Assessing whether inhibition increases with pre-incubation time

Structural Approaches:

  • Co-crystallization: Attempting to obtain crystal structures of uppP-inhibitor complexes

  • Molecular docking: Using computational methods to predict binding modes

  • Hydrogen-deuterium exchange mass spectrometry: Identifying regions of uppP protected from solvent upon inhibitor binding

Cellular Validation:

  • Growth inhibition assays: Testing effects of inhibitors on bacterial growth

  • Synergy testing: Evaluating combinations with other antimicrobials

  • Resistance development: Monitoring for emergence of resistance mutations in uppP

How does uppP activity correlate with bacterial growth and stress responses in methylotrophic metabolism?

The correlation between uppP activity and bacterial growth/stress responses in methylotrophic metabolism represents an interesting intersection of cell envelope maintenance and specialized carbon metabolism. In methylotrophic bacteria like M. flagellatus, this relationship has several dimensions:

Methylotrophic Growth Considerations:
M. flagellatus utilizes the RuMP cycle for methylotrophic growth, showing robust growth only on methanol or methylamine with doubling times comparable to natural methylotrophs (approximately 3-4 hours) . During this specialized growth mode, cell envelope synthesis must be coordinated with the unique metabolic demands of C1 utilization.

Stress Response Integration:
In bacteria like B. subtilis, depletion of UPP phosphatase activity strongly activates the σM-dependent cell envelope stress response . For M. flagellatus, comprehensive proteomics has revealed that during methylotrophic growth, the organism expresses up to 64% of its proteome, including all inferred essential proteins and those involved in auxiliary functions such as motility and polysaccharide biosynthesis . This suggests an integrated regulatory network connecting metabolism, cell envelope synthesis, and stress responses.

Growth Phase-Dependent Expression:
The expression of uppP likely varies across growth phases, with potential differential regulation between growth on methanol versus methylamine. Proteomics data indicates that protein contents in methylamine- and methanol-grown cells significantly overlap but do show metabolic enzyme differences .

Experimental Evidence from Related Systems:
Studies in other systems suggest that when UPP phosphatase activity is compromised, bacteria exhibit morphological defects consistent with cell envelope synthesis failure. These effects would be particularly significant during the rapid growth phases of methylotrophic metabolism, where efficient recycling of the lipid carrier is critical for maintaining envelope integrity.

What insights does comparative analysis between uppP enzymes from different bacterial species provide?

Comparative analysis of uppP enzymes across bacterial species provides valuable insights into evolutionary adaptations, functional conservation, and potential species-specific regulatory mechanisms:

Functional Redundancy Patterns:
Different bacterial species employ varying degrees of redundancy in UPP phosphatase activity. In B. subtilis, either UppP or BcrC can support growth, demonstrating functional redundancy . Additionally, a third lipid phosphatase (YodM) with homology to diacylglycerol pyrophosphatases can support growth when overexpressed . This redundancy pattern may vary in M. flagellatus, potentially reflecting its specialized metabolism.

Phylogenetic Distribution:
A comprehensive analysis of UPP phosphatases across bacterial phyla reveals evolutionary relationships that may correlate with cell envelope structure and complexity. M. flagellatus uppP likely shows sequence conservation with other proteobacterial homologs while maintaining species-specific features.

Domain Architecture and Catalytic Mechanisms:
Structural comparison of uppP enzymes reveals conserved catalytic domains and membrane-spanning regions. The transmembrane topology and active site architecture may show adaptations related to the lipid composition of different bacterial membranes.

Regulatory Context:
In B. subtilis, BcrC (one of the UPP phosphatases) is part of the σM regulon, linking its expression to cell envelope stress responses . Similar regulatory networks may exist in M. flagellatus, potentially connecting uppP expression to methylotrophic metabolism.

Inhibitor Susceptibility Profiles:
Different bacterial UPP phosphatases show varying susceptibility to inhibitors like bacitracin, which binds to UPP to prevent its dephosphorylation . This variation offers opportunities for developing species-selective inhibitors.

How can researchers investigate the potential of uppP as an antimicrobial target?

Investigating uppP as an antimicrobial target requires a systematic approach that evaluates its essentiality, druggability, and potential for selective inhibition. The following research strategy is recommended:

Target Validation:

  • Essentiality confirmation: Using CRISPRi or similar technologies to demonstrate that suppression of uppP activity leads to growth inhibition or cell death in the target organism .

  • Rescue experiments: Demonstrating that the growth defects can be reversed by genetic complementation or metabolic bypass.

  • In vivo relevance: Confirming the importance of uppP during infection or colonization using appropriate models.

Inhibitor Discovery:

  • High-throughput screening: Developing assays suitable for screening compound libraries against purified uppP.

  • Structure-based design: If structural data is available, using computational approaches to design potential inhibitors.

  • Repurposing strategy: Testing whether known inhibitors of related phosphatases show activity against uppP.

Selectivity Assessment:

  • Comparative inhibition: Testing candidates against human phosphatases to ensure selectivity.

  • Species selectivity: Evaluating inhibition across different bacterial UPP phosphatases to determine spectrum.

  • Resistance potential: Assessing the likelihood of resistance development through mutation studies.

Medicinal Chemistry Optimization:

  • Structure-activity relationships: Synthesizing analogs to improve potency, selectivity, and pharmacokinetic properties.

  • Prodrug approaches: Considering prodrug strategies to improve bacterial penetration.

  • Combination testing: Evaluating synergy with existing antibiotics.

How can researchers address contradictory results in uppP functional studies?

Addressing contradictory results in uppP functional studies requires systematic analysis of experimental variables and methodological approaches. Consider the following strategy:

  • Protein preparation methods: Differences in expression systems, purification protocols, and storage conditions can significantly impact enzyme activity.

  • Membrane environment: The lipid composition of membranes or detergent micelles used for assays can dramatically affect membrane protein function.

  • Assay conditions: pH, temperature, ion concentrations, and substrate preparations must be carefully controlled and reported.

Statistical Approaches:

  • Meta-analysis: Combining data from multiple studies can reveal trends that individual studies might miss.

  • Power analysis: Ensuring adequate sample sizes to detect true effects.

  • Multiple hypothesis testing correction: Applying appropriate statistical methods when comparing multiple conditions.

Collaborative Verification:

  • Ring testing: Having multiple laboratories perform identical experiments to identify lab-specific variables.

  • Standardized protocols: Developing community-accepted methods for uppP characterization.

  • Data sharing: Making raw data available for reanalysis by other researchers.

What are common challenges in expressing and characterizing membrane-associated enzymes like uppP?

Membrane-associated enzymes like uppP present significant technical challenges that can impact experimental outcomes and result interpretation:

Expression Challenges:

  • Toxicity: Overexpression of membrane proteins often causes toxicity to host cells, necessitating tightly controlled expression systems.

  • Folding and insertion: Proper folding and membrane insertion may require specific chaperones or insertion machinery that might be limiting in heterologous expression systems.

  • Post-translational modifications: Modifications necessary for function may be absent in expression hosts.

Purification Obstacles:

  • Detergent selection: Different detergents can significantly alter protein stability and activity; comprehensive detergent screening is often necessary.

  • Lipid requirements: Specific lipids may be required for structural integrity or activity.

  • Protein-detergent complex heterogeneity: Variability in the amount of bound detergent and lipid can affect functional assays.

Activity Measurement Complications:

  • Substrate accessibility: Ensuring proper orientation and accessibility of the substrate in artificial membrane systems.

  • Enzyme reconstitution: Variability in reconstitution efficiency into liposomes or nanodiscs.

  • Assay interference: Detergents and lipids can interfere with many activity assays.

Structural Analysis Difficulties:

  • Crystallization barriers: Membrane proteins are notoriously difficult to crystallize for X-ray diffraction studies.

  • Detergent micelle interference: Detergent micelles can complicate structural studies using techniques like NMR or cryo-EM.

  • Conformational heterogeneity: Membrane proteins often exist in multiple conformational states.

How should researchers interpret changes in uppP expression under different growth conditions?

Interpreting changes in uppP expression under different growth conditions requires careful consideration of both technical and biological factors:

Technical Considerations:

  • Normalization methods: When comparing expression levels across conditions, appropriate normalization to reference genes or total protein content is essential.

  • Detection sensitivity: Ensure techniques have adequate sensitivity to detect low-abundance membrane proteins like uppP.

  • Temporal dynamics: Consider whether expression measurements capture transient changes during adaptation to new conditions.

Biological Interpretation Framework:

  • Coordinate regulation: Analyze whether uppP expression changes coordinately with other cell envelope synthesis genes.

  • Stress response connection: In B. subtilis, BcrC (a UPP phosphatase) is part of the σM-dependent cell envelope stress response . Similar regulatory connections may exist for M. flagellatus uppP.

  • Growth phase considerations: Expression may vary between lag, exponential, and stationary phases. Comprehensive proteomics of M. flagellatus has shown that growth phase and substrate can influence protein expression patterns .

Comparative Analysis Approach:

  • Cross-condition comparisons: Systematically compare expression levels across carbon sources (methanol vs. methylamine) and growth phases.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to provide a comprehensive view of uppP regulation.

  • Pathway flux correlation: Correlate uppP expression with measured fluxes through cell envelope synthesis pathways.

Table 1: Factors influencing uppP expression interpretation

FactorConsiderationExperimental Approach
Growth PhaseExpression may vary between lag, exponential, and stationary phasesTime-course expression analysis
Carbon SourceMethanol vs. methylamine metabolism may differentially affect uppP expressionCompare expression across defined media
Stress ConditionsCell envelope stressors may induce uppP expressionMeasure expression after antibiotic or environmental stress
Regulatory NetworksIdentify transcription factors controlling uppP expressionChromatin immunoprecipitation or reporter assays
Post-transcriptional RegulationmRNA stability or translation efficiency may varyCompare mRNA and protein levels

What emerging technologies could advance uppP research?

The study of bacterial UPP phosphatases like uppP from M. flagellatus stands to benefit significantly from several emerging technologies that address current limitations in membrane protein research:

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy (cryo-EM): Recent advances in single-particle cryo-EM have revolutionized membrane protein structural biology, potentially allowing determination of uppP structures without crystallization.

  • Integrative structural biology: Combining multiple techniques (X-ray, NMR, cryo-EM, cross-linking) to generate comprehensive structural models.

  • Time-resolved structural methods: Capturing different conformational states during the catalytic cycle.

Innovative Functional Characterization:

  • Single-molecule enzymology: Detecting activity at the single-molecule level to reveal mechanistic heterogeneity.

  • Native mass spectrometry: Analyzing intact membrane protein complexes with bound lipids and potential interaction partners.

  • Nanoscale lipid bilayers: Using technologies like lipid nanodiscs to study uppP in defined membrane environments.

Advanced Genetic Tools:

  • Inducible CRISPRi systems: Finely tuned depletion of uppP to study phenotypic consequences at various expression levels .

  • In vivo proximity labeling: Identifying protein-protein interactions involving uppP in its native environment.

  • Base editing: Making precise point mutations without double-strand breaks to study structure-function relationships.

How might synthetic biology approaches contribute to understanding uppP function?

Synthetic biology approaches offer powerful new avenues for understanding uppP function through systematic redesign and reconstruction of cellular systems:

Minimal Cell Systems:

  • Reduced-genome chassis: Studying uppP in minimal bacterial genomes to identify essential interaction partners.

  • Cell-free expression systems: Reconstituting uppP function in defined biochemical environments.

  • Synthetic cell envelope systems: Creating artificial membranes with controlled composition to study uppP activity.

Orthogonal Expression Systems:

  • Inducible and tunable promoters: Precisely controlling uppP expression levels to determine threshold requirements.

  • Synthetic regulatory circuits: Creating artificial regulatory networks to study uppP response to various inputs.

  • Biosensors: Developing reporters of UPP/Und-P levels to monitor uppP activity in vivo.

Heterologous Expression in Model Organisms:

  • Expression in synthetic methylotrophs: Testing uppP function in engineered E. coli strains capable of methanol utilization, like the recently developed strain with a doubling time of 4.3 hours .

  • Cross-species complementation: Systematic testing of uppP function across diverse bacterial backgrounds.

  • Chimeric enzymes: Creating fusion proteins to probe domain functions and interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.