Recombinant Methylobacillus flagellatus UPF0060 membrane protein Mfla_2554 (Mfla_2554)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methylobacillus flagellatus UPF0060 Membrane Protein Mfla_2554

The recombinant Methylobacillus flagellatus UPF0060 membrane protein Mfla_2554 (UniProt ID: Q1GY68) is a full-length, His-tagged protein expressed in E. coli. This protein represents a critical component of M. flagellatus’s membrane architecture, a methylotrophic bacterium reliant on single-carbon compounds for energy and carbon assimilation . Below is a detailed analysis of its structural, functional, and biochemical characteristics.

Role in M. flagellatus Biology

  • Membrane transport: Facilitating substrate uptake or efflux.

  • Signal transduction: Participating in regulatory pathways linked to methylotrophy .

The absence of functional studies in the literature underscores the need for further characterization.

Expression and Handling

ParameterRecommendation
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) + 5–50% glycerol (for stability)
Storage-20°C/-80°C (aliquoted); avoid repeated freeze-thaw cycles
Purity AssuranceSDS-PAGE validation; >90% purity guaranteed
Adapted from

Genomic Context

The M. flagellatus genome (3 Mbp, 2,766 proteins) lacks enzymes for the tricarboxylic acid (TCA) cycle, enforcing strict reliance on methylotrophy . Membrane proteins like Mfla_2554 are critical for maintaining metabolic flux, particularly in:

  • Methanol/methylamine oxidation: Linked to electron transport chains and formaldehyde detoxification.

  • C1 assimilation: via ribulose monophosphate (RuMP) cycles .

Research Gaps and Future Directions

  1. Functional Characterization:

    • Structural studies (e.g., cryo-EM) to resolve transmembrane topology.

    • Mutant analysis to link Mfla_2554 to methylotrophic pathways .

  2. Biotechnological Applications:

    • Engineering Mfla_2554 for biosensors or biofuel production.

    • Leveraging its His-tag for affinity purification in heterologous systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Mfla_2554; UPF0060 membrane protein Mfla_2554
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Target Names
Mfla_2554
Target Protein Sequence
MFELKTVALFVITALAEIIGCYLPYLWLNQNKSPLLLIPAAISLALFAWLLTLHPSAAGR VYAAYGGVYIFVAIFWLWVVDDIIPSNWDFLGASVALLGMAIIMFAPRST
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental challenges are associated with expressing Mfla_2554?

As a membrane protein, Mfla_2554 presents several significant challenges for expression and purification:

  • Expression system selection: The hydrophobic nature of membrane proteins often leads to toxicity in heterologous expression systems, requiring specialized strains and careful optimization .

  • Translation initiation issues: Full-length expression may be hampered by improper translation initiation or premature termination. Using fusion tags on both N and C termini can help distinguish between full-length protein and truncated products .

  • Membrane insertion: Proper folding and membrane insertion require specific cellular machinery that may not be optimally compatible in heterologous systems .

  • Protein aggregation: Without appropriate detergents or membrane mimetics, membrane proteins tend to aggregate, significantly reducing yield and activity .

Researchers should consider specialized expression systems like E. coli C41/C43 strains or eukaryotic systems for challenging membrane proteins like Mfla_2554, along with careful optimization of expression conditions .

What is the optimal strategy for purifying recombinant Mfla_2554?

A comprehensive purification strategy for Mfla_2554 should include:

  • Membrane fraction isolation: Following cell lysis via methods that preserve membrane integrity (French press or sonication), isolate membrane fractions through differential centrifugation .

  • Solubilization optimization: Screen multiple detergents (DDM, LMNG, OG) at various concentrations to determine optimal solubilization conditions for Mfla_2554 .

  • Affinity chromatography: If expressing with a His-tag, use immobilized metal affinity chromatography (IMAC) with increasing imidazole concentration gradients to separate full-length protein from potential truncated products .

  • Size exclusion chromatography: As a polishing step to ensure monodispersity and remove aggregates .

  • Stability assessment: Monitor protein stability in different buffer conditions using analytical techniques such as SEC-MALS or differential scanning fluorimetry .

The typical yield for membrane proteins like Mfla_2554 ranges from 0.5-2 mg per liter of culture, which is standard for membrane proteins but significantly lower than soluble proteins .

How can researchers verify the structural integrity of purified Mfla_2554?

Multiple complementary approaches can be used to validate the structural integrity of purified Mfla_2554:

TechniqueInformation ProvidedAdvantagesLimitations
Circular Dichroism (CD)Secondary structure contentRapid assessment of foldingLimited resolution
Fluorescence-based Thermal ShiftThermal stability in various conditionsDetergent/buffer screeningIndirect measure of structure
SEC-MALSMonodispersity and oligomeric stateDetermines absolute molecular weightRequires specialized equipment
Limited proteolysisFolded domains and flexible regionsSimple to performDestructive technique
Native PAGEHomogeneity and approximate oligomeric statePreserves native interactionsSemi-quantitative

For membrane proteins like Mfla_2554, CD spectroscopy can confirm the expected high alpha-helical content typically found in transmembrane domains, while thermal stability assays can identify optimal buffer and detergent conditions for subsequent functional studies .

What methodologies are recommended for determining the function of Mfla_2554?

Since Mfla_2554 belongs to the uncharacterized UPF0060 protein family, a multi-faceted approach is needed to elucidate its function:

  • Genetic approaches:

    • Gene knockout/knockdown in Methylobacillus flagellatus followed by phenotypic characterization

    • Complementation studies to confirm phenotype specificity

    • Transcriptional analysis to identify conditions that regulate expression

  • Biochemical approaches:

    • Reconstitution into proteoliposomes to test potential transport activity

    • Protein-protein interaction studies using pull-downs or crosslinking

    • Activity assays based on hypothesized functions from bioinformatic analysis

  • Structural approaches:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • Structure-guided functional hypothesis generation

    • Site-directed mutagenesis of predicted functional residues

For membrane proteins of unknown function like Mfla_2554, correlating expression patterns with specific growth conditions can provide valuable clues about potential roles in cellular physiology .

What is known about the genomic context of Mfla_2554 and how might it inform functional studies?

Genomic context analysis provides important clues about potential functions. The Methylobacillus flagellatus KT genome has been fully sequenced, and analysis of genes surrounding Mfla_2554 can reveal functional relationships .

Interestingly, integron analysis in Methylobacillus flagellatus KT has identified gene cassettes associated with heavy metal efflux and protein folding/stability . Although direct evidence linking Mfla_2554 to these processes is not available in the search results, this genomic context suggests several testable hypotheses:

  • Mfla_2554 may function in membrane stress response

  • The protein could be involved in heavy metal homeostasis

  • It may play a role in maintaining membrane protein stability under stress conditions

Research approaches might include:

  • Testing growth phenotypes under metal stress conditions

  • Measuring metal accumulation in wildtype versus Mfla_2554 knockout strains

  • Investigating protein expression changes during environmental stress responses

The association with integrons also suggests that Mfla_2554 may have been subject to horizontal gene transfer, which could provide insights into its evolutionary history and potential specialized functions .

How can advanced structural biology techniques be applied to study Mfla_2554?

Cutting-edge structural biology approaches offer promising avenues for investigating Mfla_2554:

  • Integrative structural biology: Combining multiple experimental techniques (X-ray crystallography, NMR, cryo-EM) with computational modeling to overcome the challenges of membrane protein structure determination.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map solvent-accessible regions and conformational dynamics without requiring crystallization.

  • Single-particle cryo-EM: Recent advances have made it possible to determine structures of smaller membrane proteins, though Mfla_2554's 110 amino acid size presents a challenge.

  • Molecular dynamics simulations: To predict protein behavior in membrane environments and identify potential conformational changes relevant to function.

  • AlphaFold2 or RoseTTAFold predictions: These AI-based structure prediction tools have shown remarkable accuracy for membrane proteins and could provide initial structural models for experimental validation.

The resulting structural insights could reveal functional motifs, potential binding sites, and conformational states that inform hypothesis-driven functional studies .

What role might Mfla_2554 play in Methylobacillus flagellatus biology in relation to integron systems?

Integrons are genetic elements that facilitate horizontal gene transfer and allow bacteria to integrate and express foreign DNA . The presence of Mfla_2554 in the context of Methylobacillus flagellatus integron systems raises interesting research questions:

  • Adaptive functions: Genes associated with integrons often confer adaptive advantages under specific environmental conditions, suggesting Mfla_2554 may provide selective benefits in certain ecological niches .

  • Horizontal transfer potential: Proteins associated with integrons may be more frequently transferred between bacterial species, raising questions about the distribution of Mfla_2554 homologs across bacterial taxa .

  • Functional relationship with other integron genes: The co-occurrence with heavy metal efflux genes suggests potential functional relationships in environmental adaptation .

Research approaches to investigate these questions include:

  • Comparative genomic analysis across Methylobacillus species and related methylotrophs

  • Testing phenotypic effects of Mfla_2554 expression in heterologous hosts

  • Investigating co-regulation with other integron-associated genes

Understanding the relationship between Mfla_2554 and integron systems could provide insights into bacterial adaptation mechanisms and the evolution of specialized membrane proteins .

How should researchers design site-directed mutagenesis experiments to probe Mfla_2554 function?

Site-directed mutagenesis represents a powerful approach for investigating membrane protein function. For Mfla_2554, a systematic mutagenesis strategy should include:

  • Conservation-guided targeting: Identify highly conserved residues across UPF0060 family members as likely functional hotspots.

  • Transmembrane domain analysis: Focus on charged or polar residues within predicted transmembrane regions, as these often have critical functional roles.

  • Systematic scanning approach:

Mutation CategoryTarget ResiduesRationaleExpected Outcome
Conserved residuesW, Y, F in TM regionsPotential functional importanceAffect specific activity
Charged residuesD, E, K, RElectrostatic interactionsDisrupt protein interactions
Helix interfaceA, G, S at predicted interfacesHelix-helix packingAlter oligomerization
C-terminal mutationsLast 10 residuesC-terminal functionMay affect trafficking/stability
  • Functional validation: For each mutant, assess:

    • Expression level and membrane localization

    • Protein stability and folding

    • Specific functional assays based on hypothesized function

This systematic approach allows mapping of structure-function relationships even without a high-resolution structure and can identify critical residues for further investigation .

What experimental controls are critical when studying recombinant Mfla_2554 in heterologous systems?

  • Expression verification controls:

    • Western blotting with tag-specific and, if available, Mfla_2554-specific antibodies

    • Mass spectrometry confirmation of protein identity

    • Subcellular fractionation to confirm membrane localization

  • Functional assay controls:

    • Empty vector/host cells to account for background activity

    • Inactive mutant (e.g., predicted active site mutation) as negative control

    • Well-characterized related protein as positive control if available

  • Protein quality controls:

    • SEC analysis to confirm monodispersity

    • Thermal stability assays to ensure proper folding

    • Detergent screening to identify stabilizing conditions

  • Physiological relevance controls:

    • Comparison of recombinant protein to native Mfla_2554 when possible

    • Validation of key findings in Methylobacillus flagellatus if feasible

    • Complementation of knockout phenotypes with wild-type and mutant versions

These controls help distinguish genuine findings from artifacts of heterologous expression and are particularly important for membrane proteins like Mfla_2554, which are sensitive to their lipid environment .

How does Mfla_2554 compare to other bacterial UPF0060 family proteins?

Comparative analysis of Mfla_2554 with other UPF0060 family members can provide evolutionary and functional insights:

  • Sequence conservation patterns: Highly conserved residues likely represent functionally or structurally critical elements. UPF0060 proteins typically show conservation in transmembrane regions with greater variability in loop regions.

  • Taxonomic distribution: Understanding which bacterial lineages contain UPF0060 family members can suggest functional contexts. These proteins are found across multiple bacterial phyla, indicating ancient evolutionary origins .

  • Genomic context conservation: Whether UPF0060 proteins consistently appear near certain genes can suggest functional relationships. In some cases, including Methylobacillus flagellatus, they appear in genomic regions associated with mobile genetic elements .

  • Structural comparisons: Predicted or experimentally determined structures of UPF0060 family members might reveal conserved structural features despite sequence divergence.

This comparative approach can guide experimental design by identifying the most conserved features likely to be functionally significant and suggesting potential roles based on associated genes in well-characterized organisms .

What can integron analysis tell us about the evolutionary history of Mfla_2554?

Integrons are genetic elements that facilitate horizontal gene transfer and have been associated with Methylobacillus flagellatus genes involved in heavy metal efflux and protein stability . Analysis of Mfla_2554 in this context provides evolutionary insights:

  • Horizontally transferred origins: Genes associated with integrons often show evidence of horizontal gene transfer. Phylogenetic analysis comparing Mfla_2554 sequences to species phylogenies could reveal incongruence suggestive of horizontal transfer .

  • Selection pressure: dN/dS ratio analysis could identify whether Mfla_2554 has undergone positive selection, as has been observed in some integron-associated genes in Vibrio and Shewanella species .

  • Functional adaptation: The association with integrons suggests Mfla_2554 may confer selective advantages under specific environmental conditions, potentially related to its membrane localization .

  • Mobility potential: Examining similar genetic contexts across bacterial species could reveal whether the Mfla_2554 gene has been mobilized multiple times in evolutionary history .

Understanding these evolutionary patterns can provide context for functional studies and may suggest environmental conditions under which Mfla_2554 confers adaptive advantages .

What are the most promising research avenues for elucidating Mfla_2554 function?

Based on current knowledge, several research directions show particular promise:

  • Integrative structural biology: Combining computational prediction, biochemical mapping, and structural techniques to determine the 3D structure, which would accelerate functional hypothesis generation.

  • Systems biology approaches: Analyzing the effects of Mfla_2554 deletion or overexpression on global cellular physiology through transcriptomics, proteomics, and metabolomics.

  • Environmental adaptation studies: Testing the role of Mfla_2554 under various stress conditions, particularly those related to heavy metal exposure, based on its genomic association with metal efflux systems .

  • Protein-protein interaction networks: Identifying binding partners through approaches optimized for membrane proteins could reveal functional relationships.

  • Comparative genomics across methylotrophs: Analyzing the conservation and genomic context of Mfla_2554 homologs across methylotrophic bacteria could suggest specialized roles in C1 metabolism.

The uncharacterized nature of UPF0060 family proteins presents both a challenge and an opportunity to discover novel membrane protein functions that may have applications in biotechnology and our understanding of bacterial physiology .

What technological developments would most advance Mfla_2554 research?

Several emerging technologies could significantly accelerate research on challenging membrane proteins like Mfla_2554:

  • Improved membrane protein expression systems: Development of specialized cell-free systems or engineered cellular hosts optimized for membrane protein expression.

  • Advanced membrane mimetics: Novel nanodiscs, lipid cubic phase systems, or synthetic membrane environments that better maintain native conformations.

  • High-throughput functional screening: Development of assays capable of testing multiple potential functions in parallel to accelerate functional characterization.

  • Single-molecule approaches: Techniques like single-molecule FRET or force spectroscopy that can reveal dynamic properties and rare conformational states.

  • Machine learning integration: AI approaches that can better predict membrane protein structure, dynamics, and potential ligands from limited experimental data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.