Recombinant Methylobacterium chloromethanicum Glycerol-3-phosphate acyltransferase (plsY) is a His-tagged enzyme expressed in Escherichia coli for research applications. It belongs to the glycerol-3-phosphate acyltransferase family, catalyzing the transfer of acyl groups to glycerol-3-phosphate (G3P) during lipid biosynthesis. This enzyme is critical for membrane lipid assembly in bacteria, with potential roles in metabolic pathways linked to carbon utilization and stress adaptation.
The enzyme’s sequence includes conserved motifs for acyltransferase activity, such as hydrophobic regions and catalytic residues. A partial sequence provided in commercial databases highlights key domains:
Partial AA Sequence:
MTTLLAAGWPVLITALVLGYACGAIPFGLILTKFAGLGDVRTIGSGNIGATNVLRTGRKG LAAATLLCDALKGTLPVLAASHWGEGPALAAGLGAFLGHLFPVWLGFKGGKGVATFIGVL LALSPVTLAAFAAIWLGLAFALKYSSLAALAASAATPLILWALGHGAVAALFLVLAALLW WKHAPNIRRLAAGTEGRIGKKG
Glycerol-3-phosphate acyltransferases (GPATs) initiate lipid biosynthesis by acylating G3P to form lysophosphatidic acid (LPA), a precursor for phospholipids and glycolipids. In Methylobacterium chloromethanicum, plsY likely contributes to:
Membrane lipid synthesis, ensuring structural integrity.
Response to environmental stress, such as osmotic or thermal changes.
While specific studies on plsY’s substrate specificity or kinetic parameters are lacking in the provided sources, analogous GPATs in other bacteria (e.g., Mycobacterium) exhibit strict acyl-CoA preferences and positional selectivity (e.g., sn-1 vs. sn-2 acylation) .
Enzymatic assays: Used to study acylation kinetics and substrate competition.
Lipidomics: Tools for analyzing bacterial lipid metabolism in Methylobacterium species.
KEGG: mch:Mchl_3637
Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that plays a crucial role in bacterial phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acylphosphate to glycerol 3-phosphate, which represents a critical step in the formation of phosphatidic acid, the precursor for membrane phospholipids . In the most widely distributed bacterial phospholipid biosynthesis pathway, PlsX first converts acyl-acyl carrier protein to acylphosphate, then PlsY transfers the acyl group to glycerol 3-phosphate . This reaction is considered rate-limiting in triacylglycerol and phospholipid biosynthesis, making PlsY a pivotal enzyme for bacterial membrane formation and integrity .
Methylobacterium chloromethanicum belongs to the alpha subclass of proteobacteria and is characterized by its ability to utilize chloromethane as a sole carbon and energy source . While sharing some metabolic pathways with other methylotrophic bacteria, Methylobacterium species exhibit unique genomic features. For instance, when comparing Methylobacterium extorquens strains AM1 and DM4, researchers found that while their chromosomes are highly syntenic and share a majority of genes, there are strain-specific plasmids and insertion elements that contribute to genomic plasticity . Specifically, M. chloromethanicum possesses an inducible enzyme system for chloromethane utilization involving two key polypeptides: CmuA (67 kDa) and CmuB (35 kDa) . These adaptations allow Methylobacterium to occupy ecological niches where chlorinated methane compounds are available.
For optimal preservation of recombinant Methylobacterium chloromethanicum plsY activity, the following storage and reconstitution protocols are recommended:
Storage conditions:
Store lyophilized protein at -20°C/-80°C upon receipt
After reconstitution, aliquot to avoid repeated freeze-thaw cycles
Working aliquots may be stored at 4°C for up to one week
For long-term storage, add glycerol to a final concentration of 5-50% (recommended: 50%) and store at -20°C/-80°C
Reconstitution protocol:
Briefly centrifuge the vial before opening to bring contents to the bottom
Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL
The protein is supplied in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0
Proper storage and handling are critical as repeated freeze-thaw cycles can significantly reduce enzyme activity and stability.
To assess the enzymatic activity of recombinant Methylobacterium chloromethanicum plsY, researchers can utilize several approaches:
Acyltransferase activity assay:
Prepare a reaction mixture containing acylphosphate (substrate), glycerol 3-phosphate, and appropriate buffer
Add the recombinant plsY enzyme
Measure the formation of acyl-glycerol-3-phosphate (product) using chromatographic techniques such as HPLC or LC-MS
Calculate enzyme activity based on product formation rate
Substrate specificity analysis:
Test the enzyme with different acyl chain lengths to determine preference
Compare kinetic parameters (Km, Vmax) for different substrates
Note that PlsY is known to be noncompetitively inhibited by palmitoyl-CoA
Site-directed mutagenesis validation:
Based on research with other bacterial PlsY proteins, mutations in conserved motifs can confirm active site residues
Motif 1 likely contains essential serine and arginine residues
Motif 2 exhibits characteristics of a phosphate-binding loop critical for glycerol 3-phosphate binding
Motif 3 contains conserved histidine and asparagine residues important for activity
The recombinant Methylobacterium chloromethanicum plsY protein can be successfully expressed in E. coli expression systems . When designing expression protocols, researchers should consider the following factors:
Expression vector considerations:
Include an appropriate tag (His-tag is commonly used) to facilitate purification
Select a promoter with controllable expression levels to optimize protein folding
Consider codon optimization for expressing Methylobacterium proteins in E. coli
Expression conditions:
Temperature: Lower temperatures (16-25°C) often improve membrane protein folding
Induction: Gradual induction with lower concentrations of inducers may improve functional expression
Media supplements: Addition of specific phospholipids or membrane-stabilizing agents may improve yield
Membrane protein challenges:
As plsY is an integral membrane protein with five transmembrane segments , consider using specialized strains designed for membrane protein expression
Detergent screening may be necessary to identify optimal solubilization conditions
Consider incorporating lipid nanodiscs or other membrane mimetics for functional studies
Site-directed mutagenesis represents a powerful approach to probe the structure-function relationships of Methylobacterium chloromethanicum plsY. Based on homology with other bacterial plsY proteins, researchers should focus on the three conserved motifs:
Motif 1 analysis:
Target the conserved serine and arginine residues that are likely essential for catalysis
Mutations like S→A or R→K can reveal the importance of these residues in substrate binding or catalysis
Kinetic analysis of mutants can differentiate between effects on substrate binding (Km) versus catalytic efficiency (kcat)
Motif 2 (phosphate-binding loop) investigation:
Focus on conserved glycine residues that are critical for glycerol 3-phosphate binding
G→A mutations typically result in increased Km for glycerol 3-phosphate, confirming their role in substrate binding
Structural changes in this region can dramatically alter substrate specificity
Motif 3 functional analysis:
Examine the roles of conserved histidine and asparagine residues through H→A and N→A mutations
The conserved glutamate is likely critical for structural integrity and should be analyzed through E→D and E→Q substitutions
Correlate mutational effects with structural predictions to develop a functional model
Experimental design considerations:
Create a panel of single and double mutants
Characterize each mutant for expression, membrane integration, and catalytic activity
Perform complementation studies in plsY-deficient bacterial strains
Use computational modeling to predict structural changes and correlate with experimental findings
Understanding the evolutionary and functional differences between plsY homologs provides insight into bacterial adaptations and potential biotechnological applications:
Structural comparison:
Functional divergence:
Substrate specificity differences may exist for acyl chain length preferences
Kinetic parameters (Km, Vmax, inhibition constants) likely vary between species
Environmental adaptations (temperature optima, pH sensitivity) should correlate with bacterial habitat
Comparative analysis approach:
Perform multiple sequence alignment of plsY from diverse bacterial species
Identify universally conserved residues versus lineage-specific adaptations
Correlate sequence differences with biochemical properties and ecological niches
Use heterologous expression to directly compare enzymatic properties
The acyltransferase activity of plsY makes it a valuable enzyme for various synthetic biology applications:
Engineered phospholipid production:
Incorporation of plsY into artificial pathways for producing novel phospholipids
Combination with modified glycerol-3-phosphate precursors could generate phospholipids with altered properties
Co-expression with other enzymes in the phospholipid biosynthesis pathway for complete synthetic routes
Metabolic engineering applications:
Integration into methylotrophic pathways for valorization of C1 compounds
Creation of hybrid biosynthetic pathways linking methylotrophy with lipid production
Development of bacterial strains with enhanced membrane properties for bioremediation
Biotechnological considerations:
Optimize codon usage for expression in industrial production hosts
Engineer protein stability for industrial-scale applications
Consider immobilization strategies for continuous bioprocessing
Design control systems (inducible promoters, riboswitch regulators) for dynamic regulation
Researchers working with recombinant Methylobacterium chloromethanicum plsY encounter several technical challenges:
Protein solubility and stability issues:
Problem: As an integral membrane protein, plsY has low solubility in aqueous buffers
Solution: Use appropriate detergents (DDM, LDAO, etc.) for solubilization; screen detergent types and concentrations
Approach: Consider fusion partners (MBP, SUMO) that can enhance solubility during expression
Activity loss during purification:
Problem: Functional activity may decrease during purification steps
Solution: Minimize time between steps, maintain cold temperatures, add stabilizing agents
Approach: Include glycerol (5-20%) and reducing agents in all buffers
Reconstitution difficulties:
Problem: Inconsistent activity after reconstitution from lyophilized state
Solution: Follow optimized reconstitution protocol with controlled hydration rate
Approach: Add phospholipids or membrane mimetics to stabilize the reconstituted protein
Assay interference:
Problem: Components in expression system may interfere with activity measurements
Solution: Include appropriate controls and blanks in all assays
Approach: Validate results using multiple analytical methods
Optimizing the heterologous expression of Methylobacterium chloromethanicum plsY requires addressing several parameters:
Expression strain selection:
E. coli strains specialized for membrane protein expression (C41, C43, Lemo21)
Consider Methylobacterium-related expression hosts for more native-like membrane environment
Test multiple strains with varying membrane compositions
Induction optimization table:
| Parameter | Range to Test | Optimization Goal |
|---|---|---|
| Temperature | 16-37°C | Balance between expression level and proper folding |
| Inducer concentration | 0.01-1.0 mM IPTG | Minimize aggregation while maximizing yield |
| Induction time | 4-24 hours | Maximize functional protein accumulation |
| Media composition | LB, TB, M9, autoinduction | Support membrane protein biosynthesis |
| Additives | Glycerol, specific lipids | Enhance membrane protein folding |
Purification strategy:
Gentle cell lysis (enzymatic or pressure-based) to preserve membrane integrity
Membrane fraction isolation before detergent solubilization
Two-step purification (e.g., IMAC followed by size exclusion chromatography)
Quality control via SDS-PAGE, Western blot, and activity assays at each step
A comprehensive characterization of Methylobacterium chloromethanicum plsY requires multiple analytical approaches:
Structural characterization:
Circular dichroism (CD) spectroscopy to assess secondary structure composition
Limited proteolysis combined with mass spectrometry to identify domain boundaries
Crosslinking studies to identify interacting regions
For high-resolution analysis, consider X-ray crystallography of the protein in lipidic cubic phase or cryo-electron microscopy
Functional analysis:
Enzyme kinetics with varied substrate concentrations to determine Km and Vmax
Substrate specificity profiling using acyl chains of different lengths
Inhibition studies to identify regulatory mechanisms (note that PlsY is noncompetitively inhibited by palmitoyl-CoA)
pH and temperature profiling to determine optimal conditions
Membrane topology analysis:
Substituted cysteine accessibility method (SCAM) to map transmembrane regions
Fluorescence-based approaches to monitor conformational changes
Computational modeling validated by experimental constraints
The function of plsY in Methylobacterium chloromethanicum intersects with the organism's specialized methylotrophic metabolism in several key ways:
Metabolic integration:
As Methylobacterium species can grow on reduced C1 compounds without carbon-carbon bonds , their central metabolism must efficiently channel these substrates into biosynthetic pathways
plsY likely plays a critical role in directing carbon flux from methylotrophic pathways toward membrane phospholipid synthesis
The rate-limiting nature of plsY activity suggests it may serve as a metabolic control point between growth and membrane biosynthesis
Chloromethane utilization connection:
Methylobacterium chloromethanicum possesses specialized gene clusters for utilizing chlorinated methane compounds
Growth on chloromethane requires adaptive membrane compositions to handle potential toxicity
plsY activity may be regulated in response to chloromethane-induced stress
C1 transfer pathway involvement:
Methylobacterium species contain folD genes coding for methylene-tetrahydrofolate cyclohydrolase , which is involved in C1 transfer pathways
These pathways connect with phospholipid biosynthesis at several metabolic junctions
The regulatory relationship between C1 metabolism and plsY activity represents an important area for further research
Understanding the functional relationships between plsY and other methylotrophic enzymes provides insight into the integrated metabolism of Methylobacterium chloromethanicum:
Enzymatic network:
The chloromethane utilization (cmu) gene cluster in related organisms contains multiple enzymes that channel carbon from chloromethane into central metabolism
plsY activity must be coordinated with these specialized pathways to balance growth with membrane biosynthesis
Regulatory mechanisms likely exist to coordinate carbon flux between methylotrophic pathways and lipid synthesis
Comparative pathway analysis:
Chloromethane utilization involves corrinoid-dependent methyl transfer systems including CmuA and CmuB proteins
These systems generate C1 units that enter central metabolism
plsY utilizes metabolic intermediates to initiate phospholipid synthesis
Balancing these pathways requires sophisticated regulatory mechanisms
Research approaches:
Transcriptomic analysis to identify co-regulated gene clusters
Metabolic flux analysis using labeled substrates
Proteomic studies to identify potential protein-protein interactions
Systems biology modeling to predict metabolic responses to environmental changes
Research on Methylobacterium chloromethanicum plsY provides valuable insights into bacterial adaptation mechanisms:
Evolutionary significance:
Methylobacterium species show remarkable genomic plasticity with numerous insertion elements and strain-specific plasmids
The acquisition or modification of key enzymes like plsY likely contributed to adaptation to specialized ecological niches
Comparative genomics across Methylobacterium strains can reveal selective pressures on lipid metabolism genes
Ecological adaptations:
Methylobacterium chloromethanicum's ability to utilize chloromethane as a sole carbon source represents a specialized adaptation
Membrane composition, controlled in part by plsY activity, must be optimized for growth in these conditions
Understanding plsY regulation may reveal mechanisms of bacterial adaptation to harsh environments
Biotechnological applications:
Insights from plsY research could inform development of bacteria for bioremediation of chlorinated solvents
Engineering plsY and related enzymes might enable creation of synthetic organisms with novel substrate utilization capabilities
Knowledge of membrane adaptation mechanisms could improve industrial strain robustness
Several exciting research avenues emerge from our current understanding of Methylobacterium chloromethanicum plsY:
Structural biology approaches:
High-resolution structure determination would provide unprecedented insights into catalytic mechanism
Comparative structural analysis across bacterial species could reveal evolutionary adaptations
Structure-guided enzyme engineering could create variants with novel properties
Systems biology integration:
Multi-omics approaches to understand plsY regulation in different growth conditions
Metabolic modeling to predict the effects of plsY modifications on cellular physiology
Synthetic biology applications combining plsY with engineered metabolic pathways
Environmental applications:
Development of biosensors based on plsY activity for detecting environmental contaminants
Engineering Methylobacterium strains with modified plsY for enhanced bioremediation capabilities
Understanding adaptation mechanisms in extreme environments through plsY research
Methodological advances:
Development of high-throughput screening methods for plsY variants
In situ studies of plsY function within native membranes
Advanced imaging techniques to visualize plsY localization and dynamics