Recombinant Methylobacterium chloromethanicum Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methylobacterium chloromethanicum Glycerol-3-phosphate Acyltransferase (plsY)

Recombinant Methylobacterium chloromethanicum Glycerol-3-phosphate acyltransferase (plsY) is a His-tagged enzyme expressed in Escherichia coli for research applications. It belongs to the glycerol-3-phosphate acyltransferase family, catalyzing the transfer of acyl groups to glycerol-3-phosphate (G3P) during lipid biosynthesis. This enzyme is critical for membrane lipid assembly in bacteria, with potential roles in metabolic pathways linked to carbon utilization and stress adaptation.

Amino Acid Sequence

The enzyme’s sequence includes conserved motifs for acyltransferase activity, such as hydrophobic regions and catalytic residues. A partial sequence provided in commercial databases highlights key domains:

Partial AA Sequence:
MTTLLAAGWPVLITALVLGYACGAIPFGLILTKFAGLGDVRTIGSGNIGATNVLRTGRKG LAAATLLCDALKGTLPVLAASHWGEGPALAAGLGAFLGHLFPVWLGFKGGKGVATFIGVL LALSPVTLAAFAAIWLGLAFALKYSSLAALAASAATPLILWALGHGAVAALFLVLAALLW WKHAPNIRRLAAGTEGRIGKKG

Functional Role in Lipid Metabolism

Glycerol-3-phosphate acyltransferases (GPATs) initiate lipid biosynthesis by acylating G3P to form lysophosphatidic acid (LPA), a precursor for phospholipids and glycolipids. In Methylobacterium chloromethanicum, plsY likely contributes to:

  • Membrane lipid synthesis, ensuring structural integrity.

  • Response to environmental stress, such as osmotic or thermal changes.

While specific studies on plsY’s substrate specificity or kinetic parameters are lacking in the provided sources, analogous GPATs in other bacteria (e.g., Mycobacterium) exhibit strict acyl-CoA preferences and positional selectivity (e.g., sn-1 vs. sn-2 acylation) .

Biochemical Studies

  • Enzymatic assays: Used to study acylation kinetics and substrate competition.

  • Lipidomics: Tools for analyzing bacterial lipid metabolism in Methylobacterium species.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All protein shipments are standard with normal blue ice packs. For dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To optimize long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life can be influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the solution for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Mchl_3637; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Methylobacterium extorquens (strain CM4 / NCIMB 13688) (Methylobacterium chloromethanicum)
Target Names
plsY
Target Protein Sequence
MTTLLAAGWPVLITALVLGYACGAIPFGLILTKFAGLGDVRTIGSGNIGATNVLRTGRKG LAAATLLCDALKGTLPVLAASHWGEGPALAAGLGAFLGHLFPVWLGFKGGKGVATFIGVL LALSPVTLAAFAAIWLGLAFALKYSSLAALAASAATPLILWALGHGAVAALFLVLAALLW WKHAPNIRRLAAGTEGRIGKKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its role in bacterial metabolism?

Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that plays a crucial role in bacterial phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acylphosphate to glycerol 3-phosphate, which represents a critical step in the formation of phosphatidic acid, the precursor for membrane phospholipids . In the most widely distributed bacterial phospholipid biosynthesis pathway, PlsX first converts acyl-acyl carrier protein to acylphosphate, then PlsY transfers the acyl group to glycerol 3-phosphate . This reaction is considered rate-limiting in triacylglycerol and phospholipid biosynthesis, making PlsY a pivotal enzyme for bacterial membrane formation and integrity .

How does Methylobacterium chloromethanicum differ from other methylotrophic bacteria?

Methylobacterium chloromethanicum belongs to the alpha subclass of proteobacteria and is characterized by its ability to utilize chloromethane as a sole carbon and energy source . While sharing some metabolic pathways with other methylotrophic bacteria, Methylobacterium species exhibit unique genomic features. For instance, when comparing Methylobacterium extorquens strains AM1 and DM4, researchers found that while their chromosomes are highly syntenic and share a majority of genes, there are strain-specific plasmids and insertion elements that contribute to genomic plasticity . Specifically, M. chloromethanicum possesses an inducible enzyme system for chloromethane utilization involving two key polypeptides: CmuA (67 kDa) and CmuB (35 kDa) . These adaptations allow Methylobacterium to occupy ecological niches where chlorinated methane compounds are available.

What are the optimal storage and reconstitution conditions for recombinant Methylobacterium chloromethanicum plsY?

For optimal preservation of recombinant Methylobacterium chloromethanicum plsY activity, the following storage and reconstitution protocols are recommended:

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (recommended: 50%) and store at -20°C/-80°C

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • The protein is supplied in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

Proper storage and handling are critical as repeated freeze-thaw cycles can significantly reduce enzyme activity and stability.

How can researchers confirm the activity of recombinant Methylobacterium chloromethanicum plsY in experimental settings?

To assess the enzymatic activity of recombinant Methylobacterium chloromethanicum plsY, researchers can utilize several approaches:

Acyltransferase activity assay:

  • Prepare a reaction mixture containing acylphosphate (substrate), glycerol 3-phosphate, and appropriate buffer

  • Add the recombinant plsY enzyme

  • Measure the formation of acyl-glycerol-3-phosphate (product) using chromatographic techniques such as HPLC or LC-MS

  • Calculate enzyme activity based on product formation rate

Substrate specificity analysis:

  • Test the enzyme with different acyl chain lengths to determine preference

  • Compare kinetic parameters (Km, Vmax) for different substrates

  • Note that PlsY is known to be noncompetitively inhibited by palmitoyl-CoA

Site-directed mutagenesis validation:

  • Based on research with other bacterial PlsY proteins, mutations in conserved motifs can confirm active site residues

  • Motif 1 likely contains essential serine and arginine residues

  • Motif 2 exhibits characteristics of a phosphate-binding loop critical for glycerol 3-phosphate binding

  • Motif 3 contains conserved histidine and asparagine residues important for activity

What expression systems are most effective for producing functional recombinant Methylobacterium chloromethanicum plsY?

The recombinant Methylobacterium chloromethanicum plsY protein can be successfully expressed in E. coli expression systems . When designing expression protocols, researchers should consider the following factors:

Expression vector considerations:

  • Include an appropriate tag (His-tag is commonly used) to facilitate purification

  • Select a promoter with controllable expression levels to optimize protein folding

  • Consider codon optimization for expressing Methylobacterium proteins in E. coli

Expression conditions:

  • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

  • Induction: Gradual induction with lower concentrations of inducers may improve functional expression

  • Media supplements: Addition of specific phospholipids or membrane-stabilizing agents may improve yield

Membrane protein challenges:

  • As plsY is an integral membrane protein with five transmembrane segments , consider using specialized strains designed for membrane protein expression

  • Detergent screening may be necessary to identify optimal solubilization conditions

  • Consider incorporating lipid nanodiscs or other membrane mimetics for functional studies

How can researchers utilize site-directed mutagenesis to investigate Methylobacterium chloromethanicum plsY function?

Site-directed mutagenesis represents a powerful approach to probe the structure-function relationships of Methylobacterium chloromethanicum plsY. Based on homology with other bacterial plsY proteins, researchers should focus on the three conserved motifs:

Motif 1 analysis:

  • Target the conserved serine and arginine residues that are likely essential for catalysis

  • Mutations like S→A or R→K can reveal the importance of these residues in substrate binding or catalysis

  • Kinetic analysis of mutants can differentiate between effects on substrate binding (Km) versus catalytic efficiency (kcat)

Motif 2 (phosphate-binding loop) investigation:

  • Focus on conserved glycine residues that are critical for glycerol 3-phosphate binding

  • G→A mutations typically result in increased Km for glycerol 3-phosphate, confirming their role in substrate binding

  • Structural changes in this region can dramatically alter substrate specificity

Motif 3 functional analysis:

  • Examine the roles of conserved histidine and asparagine residues through H→A and N→A mutations

  • The conserved glutamate is likely critical for structural integrity and should be analyzed through E→D and E→Q substitutions

  • Correlate mutational effects with structural predictions to develop a functional model

Experimental design considerations:

  • Create a panel of single and double mutants

  • Characterize each mutant for expression, membrane integration, and catalytic activity

  • Perform complementation studies in plsY-deficient bacterial strains

  • Use computational modeling to predict structural changes and correlate with experimental findings

What are the comparative differences between plsY from Methylobacterium chloromethanicum and other bacterial species?

Understanding the evolutionary and functional differences between plsY homologs provides insight into bacterial adaptations and potential biotechnological applications:

Structural comparison:

Functional divergence:

  • Substrate specificity differences may exist for acyl chain length preferences

  • Kinetic parameters (Km, Vmax, inhibition constants) likely vary between species

  • Environmental adaptations (temperature optima, pH sensitivity) should correlate with bacterial habitat

Comparative analysis approach:

  • Perform multiple sequence alignment of plsY from diverse bacterial species

  • Identify universally conserved residues versus lineage-specific adaptations

  • Correlate sequence differences with biochemical properties and ecological niches

  • Use heterologous expression to directly compare enzymatic properties

How can Methylobacterium chloromethanicum plsY be utilized in synthetic biology applications?

The acyltransferase activity of plsY makes it a valuable enzyme for various synthetic biology applications:

Engineered phospholipid production:

  • Incorporation of plsY into artificial pathways for producing novel phospholipids

  • Combination with modified glycerol-3-phosphate precursors could generate phospholipids with altered properties

  • Co-expression with other enzymes in the phospholipid biosynthesis pathway for complete synthetic routes

Metabolic engineering applications:

  • Integration into methylotrophic pathways for valorization of C1 compounds

  • Creation of hybrid biosynthetic pathways linking methylotrophy with lipid production

  • Development of bacterial strains with enhanced membrane properties for bioremediation

Biotechnological considerations:

  • Optimize codon usage for expression in industrial production hosts

  • Engineer protein stability for industrial-scale applications

  • Consider immobilization strategies for continuous bioprocessing

  • Design control systems (inducible promoters, riboswitch regulators) for dynamic regulation

What are the common pitfalls in experimental work with Methylobacterium chloromethanicum plsY and how can they be addressed?

Researchers working with recombinant Methylobacterium chloromethanicum plsY encounter several technical challenges:

Protein solubility and stability issues:

  • Problem: As an integral membrane protein, plsY has low solubility in aqueous buffers

  • Solution: Use appropriate detergents (DDM, LDAO, etc.) for solubilization; screen detergent types and concentrations

  • Approach: Consider fusion partners (MBP, SUMO) that can enhance solubility during expression

Activity loss during purification:

  • Problem: Functional activity may decrease during purification steps

  • Solution: Minimize time between steps, maintain cold temperatures, add stabilizing agents

  • Approach: Include glycerol (5-20%) and reducing agents in all buffers

Reconstitution difficulties:

  • Problem: Inconsistent activity after reconstitution from lyophilized state

  • Solution: Follow optimized reconstitution protocol with controlled hydration rate

  • Approach: Add phospholipids or membrane mimetics to stabilize the reconstituted protein

Assay interference:

  • Problem: Components in expression system may interfere with activity measurements

  • Solution: Include appropriate controls and blanks in all assays

  • Approach: Validate results using multiple analytical methods

How can researchers optimize heterologous expression of Methylobacterium chloromethanicum plsY?

Optimizing the heterologous expression of Methylobacterium chloromethanicum plsY requires addressing several parameters:

Expression strain selection:

  • E. coli strains specialized for membrane protein expression (C41, C43, Lemo21)

  • Consider Methylobacterium-related expression hosts for more native-like membrane environment

  • Test multiple strains with varying membrane compositions

Induction optimization table:

ParameterRange to TestOptimization Goal
Temperature16-37°CBalance between expression level and proper folding
Inducer concentration0.01-1.0 mM IPTGMinimize aggregation while maximizing yield
Induction time4-24 hoursMaximize functional protein accumulation
Media compositionLB, TB, M9, autoinductionSupport membrane protein biosynthesis
AdditivesGlycerol, specific lipidsEnhance membrane protein folding

Purification strategy:

  • Gentle cell lysis (enzymatic or pressure-based) to preserve membrane integrity

  • Membrane fraction isolation before detergent solubilization

  • Two-step purification (e.g., IMAC followed by size exclusion chromatography)

  • Quality control via SDS-PAGE, Western blot, and activity assays at each step

What analytical methods are most appropriate for characterizing Methylobacterium chloromethanicum plsY structure and function?

A comprehensive characterization of Methylobacterium chloromethanicum plsY requires multiple analytical approaches:

Structural characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Limited proteolysis combined with mass spectrometry to identify domain boundaries

  • Crosslinking studies to identify interacting regions

  • For high-resolution analysis, consider X-ray crystallography of the protein in lipidic cubic phase or cryo-electron microscopy

Functional analysis:

  • Enzyme kinetics with varied substrate concentrations to determine Km and Vmax

  • Substrate specificity profiling using acyl chains of different lengths

  • Inhibition studies to identify regulatory mechanisms (note that PlsY is noncompetitively inhibited by palmitoyl-CoA)

  • pH and temperature profiling to determine optimal conditions

Membrane topology analysis:

  • Substituted cysteine accessibility method (SCAM) to map transmembrane regions

  • Fluorescence-based approaches to monitor conformational changes

  • Computational modeling validated by experimental constraints

How does plsY function relate to the unique methylotrophic metabolism of Methylobacterium chloromethanicum?

The function of plsY in Methylobacterium chloromethanicum intersects with the organism's specialized methylotrophic metabolism in several key ways:

Metabolic integration:

  • As Methylobacterium species can grow on reduced C1 compounds without carbon-carbon bonds , their central metabolism must efficiently channel these substrates into biosynthetic pathways

  • plsY likely plays a critical role in directing carbon flux from methylotrophic pathways toward membrane phospholipid synthesis

  • The rate-limiting nature of plsY activity suggests it may serve as a metabolic control point between growth and membrane biosynthesis

Chloromethane utilization connection:

  • Methylobacterium chloromethanicum possesses specialized gene clusters for utilizing chlorinated methane compounds

  • Growth on chloromethane requires adaptive membrane compositions to handle potential toxicity

  • plsY activity may be regulated in response to chloromethane-induced stress

C1 transfer pathway involvement:

  • Methylobacterium species contain folD genes coding for methylene-tetrahydrofolate cyclohydrolase , which is involved in C1 transfer pathways

  • These pathways connect with phospholipid biosynthesis at several metabolic junctions

  • The regulatory relationship between C1 metabolism and plsY activity represents an important area for further research

What is the relationship between plsY and other methylotrophic enzymes in Methylobacterium chloromethanicum?

Understanding the functional relationships between plsY and other methylotrophic enzymes provides insight into the integrated metabolism of Methylobacterium chloromethanicum:

Enzymatic network:

  • The chloromethane utilization (cmu) gene cluster in related organisms contains multiple enzymes that channel carbon from chloromethane into central metabolism

  • plsY activity must be coordinated with these specialized pathways to balance growth with membrane biosynthesis

  • Regulatory mechanisms likely exist to coordinate carbon flux between methylotrophic pathways and lipid synthesis

Comparative pathway analysis:

  • Chloromethane utilization involves corrinoid-dependent methyl transfer systems including CmuA and CmuB proteins

  • These systems generate C1 units that enter central metabolism

  • plsY utilizes metabolic intermediates to initiate phospholipid synthesis

  • Balancing these pathways requires sophisticated regulatory mechanisms

Research approaches:

  • Transcriptomic analysis to identify co-regulated gene clusters

  • Metabolic flux analysis using labeled substrates

  • Proteomic studies to identify potential protein-protein interactions

  • Systems biology modeling to predict metabolic responses to environmental changes

How can Methylobacterium chloromethanicum plsY research contribute to understanding bacterial adaptation to specialized niches?

Research on Methylobacterium chloromethanicum plsY provides valuable insights into bacterial adaptation mechanisms:

Evolutionary significance:

  • Methylobacterium species show remarkable genomic plasticity with numerous insertion elements and strain-specific plasmids

  • The acquisition or modification of key enzymes like plsY likely contributed to adaptation to specialized ecological niches

  • Comparative genomics across Methylobacterium strains can reveal selective pressures on lipid metabolism genes

Ecological adaptations:

  • Methylobacterium chloromethanicum's ability to utilize chloromethane as a sole carbon source represents a specialized adaptation

  • Membrane composition, controlled in part by plsY activity, must be optimized for growth in these conditions

  • Understanding plsY regulation may reveal mechanisms of bacterial adaptation to harsh environments

Biotechnological applications:

  • Insights from plsY research could inform development of bacteria for bioremediation of chlorinated solvents

  • Engineering plsY and related enzymes might enable creation of synthetic organisms with novel substrate utilization capabilities

  • Knowledge of membrane adaptation mechanisms could improve industrial strain robustness

What are the most promising future research directions involving Methylobacterium chloromethanicum plsY?

Several exciting research avenues emerge from our current understanding of Methylobacterium chloromethanicum plsY:

Structural biology approaches:

  • High-resolution structure determination would provide unprecedented insights into catalytic mechanism

  • Comparative structural analysis across bacterial species could reveal evolutionary adaptations

  • Structure-guided enzyme engineering could create variants with novel properties

Systems biology integration:

  • Multi-omics approaches to understand plsY regulation in different growth conditions

  • Metabolic modeling to predict the effects of plsY modifications on cellular physiology

  • Synthetic biology applications combining plsY with engineered metabolic pathways

Environmental applications:

  • Development of biosensors based on plsY activity for detecting environmental contaminants

  • Engineering Methylobacterium strains with modified plsY for enhanced bioremediation capabilities

  • Understanding adaptation mechanisms in extreme environments through plsY research

Methodological advances:

  • Development of high-throughput screening methods for plsY variants

  • In situ studies of plsY function within native membranes

  • Advanced imaging techniques to visualize plsY localization and dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.