Recombinant Methylobacterium chloromethanicum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction

Methylobacterium chloromethanicum is a methylotrophic bacterium known for its ability to utilize chloromethane as a sole carbon and energy source . It possesses an inducible enzyme system for this purpose, involving proteins such as CmuA and CmuB . Large-conductance mechanosensitive channels (MscL) are membrane proteins that respond to mechanical stress in the cell membrane. Recombinant MscL refers to MscL that is produced using recombinant DNA technology, often in a host organism like E. coli .

MscL Function and Significance

MscL channels are crucial for bacteria to survive under osmotic stress . These channels open in response to increased membrane tension, allowing the efflux of solutes to reduce turgor pressure .

Methylobacterium chloromethanicum and Chloromethane Utilization

M. chloromethanicum utilizes chloromethane through a corrinoid-dependent methyl transfer system . Genes essential for this process include cmuA, cmuB, and cmuC . These genes are involved in the utilization of chloromethane . The enzyme system involves two polypeptides, CmuA (67-kDa) and CmuB (35-kDa) .

Reclassification of Methylobacterium chloromethanicum

Phylogenetic analysis has shown that Methylobacterium strains can be divided into distinct groups . Notably, M. chloromethanicum has extremely high sequence similarity with M. extorquens and is now regarded as a synonym of M. extorquens .

Recombinant Production of MscL

Recombinant MscL from Methylobacterium chloromethanicum can be produced using in vitro E. coli expression systems .

Methyl Bromide and Cell-Cell Signaling

Variovorax beijingensis can be engineered to produce methyl halides, which can act as signaling molecules to other microbes such as M. extorquens CM4 . Methyl halide production can be used to report on a mechanosensitive channel (MSC) promoter that is activated by changes in water potential .

Potential Applications

The ability to manipulate methyl halide production in bacteria has potential applications in biosensors and community ecology studies . Understanding the responses of MSC to dynamic hydration conditions can be valuable in studying drought and flood events .

Antibiotic Sensitivity of MSC Members

AntibioticConcentration (µg/mL)
Carbenicillin
Chloramphenicol
Kanamycin
Spectinomycin
Streptomycin
Tetracycline

Note: The specific concentrations would need to be experimentally determined for each MSC member .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Mchl_2802; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Methylobacterium extorquens (strain CM4 / NCIMB 13688) (Methylobacterium chloromethanicum)
Target Names
mscL
Target Protein Sequence
MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAVTGGLDFSNYYIPLS SKVQDGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNVLKSREEAKPKPVA EVPADVKLLGEIRDLLAARRV
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Methylobacterium chloromethanicum MscL channel?

The large-conductance mechanosensitive channel (MscL) from Methylobacterium chloromethanicum is a membrane protein that forms one of the largest biological pores found in nature, with a diameter exceeding 25 Å when fully open . MscL functions as a tension-sensitive channel that gates in response to mechanical force transmitted directly from the lipid bilayer to the channel protein . The channel operates as a molecular valve, allowing the passage of large organic ions and even small proteins when activated . It's important to note that taxonomic studies have shown Methylobacterium chloromethanicum is closely related to Methylobacterium extorquens, with extremely high 16S rDNA sequence similarity (100%), leading to reclassification considerations .

What is the structural composition of the MscL channel?

MscL is a homopentameric protein complex where each monomer consists of two transmembrane (TM) helices: TM1 which lines the channel pore, and TM2 which interacts primarily with the lipid bilayer . The structure includes a crucial amphipathic N-terminal helix (previously designated S1) connected to the pore-lining TM1 helix via a glycine hinge (G14) . This arrangement is completed by a C-terminal helical bundle that forms a coiled-coil structure . The N-terminal domain plays a critical role in mechanosensing and channel gating, as demonstrated by multiple experimental approaches including EPR and molecular dynamics simulations .

How does the gating mechanism of MscL work?

The gating of MscL occurs through a complex conformational change triggered by increased membrane tension. When sufficient force is applied through the lipid bilayer, the channel undergoes a large in-plane area expansion where the pore-lining TM1 helices tilt and rotate . This movement results in solvation of the hydrophobic gate and formation of a large non-selective pore with a conductance of approximately 3 nS .

Finite element modeling has shown that during this process:

  • The TM1 and TM2 helices move outward radially, tilting toward the plane of the membrane

  • The TM1 helix tilts by approximately 21° relative to the central fivefold axis

  • The TM2 helix tilts by more than 19°

  • The lipid bilayer thins by approximately 15% (about 5 Å)

  • The N-terminal helix begins to align with TM1 as a contiguous helix in the open state

What are the recommended methods for recombinant expression of MscL?

For recombinant expression of Methylobacterium chloromethanicum MscL, researchers typically employ bacterial expression systems, particularly E. coli, using specialized vectors designed for membrane protein expression. While the search results don't specify the exact protocol for this particular species, the methodology would be similar to that used for other bacterial MscL proteins .

The expression system should include:

  • A strong inducible promoter (such as T7)

  • Affinity tags (like His6) for purification

  • Appropriate host strains optimized for membrane protein expression

  • Induction conditions optimized for proper folding rather than maximum yield

When expressing MscL in mammalian cells for functional studies, viral vectors or lipid-based transfection methods have proven successful, maintaining the channel's mechanosensitive properties across different cellular environments .

How can researchers purify recombinant MscL while maintaining its functional integrity?

Purification of MscL requires specialized techniques due to its membrane protein nature. A methodical approach includes:

  • Cell lysis under conditions that preserve protein structure

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using detergents appropriate for mechanosensitive channels (typical choices include n-Dodecyl β-D-maltoside or n-Octyl glucoside)

  • Affinity chromatography utilizing engineered tags

  • Size exclusion chromatography for final purification and buffer exchange

Critical considerations include maintaining an appropriate detergent concentration above the critical micelle concentration throughout the purification process and utilizing lipid supplementation when necessary to maintain protein stability .

What electrophysiological methods are most appropriate for studying MscL function?

Electrophysiological characterization of MscL can be performed using several complementary approaches:

  • Patch-clamp electrophysiology: This represents the gold standard for functional studies, allowing direct measurement of channel activity. Both cell-attached and excised patch configurations can be used to study MscL responses to membrane tension .

  • Planar lipid bilayer recordings: This technique enables the study of purified and reconstituted MscL in a controlled lipid environment. It allows for precise manipulation of membrane composition and tension .

  • Whole-cell recordings: When expressing MscL in mammalian cells, whole-cell patch-clamp can be used to measure channel activity in response to various stimuli, including osmotic challenges or membrane-stretching protocols .

Each of these methods provides unique insights into channel function, with patch-clamp allowing single-channel resolution and planar bilayer systems offering greater control over the membrane environment.

How can researchers assess MscL-mediated molecular transport?

To evaluate the molecular transport capabilities of MscL channels:

  • Fluorescent marker uptake assays: Utilizing membrane-impermeable fluorescent molecules of varying molecular weights to determine size limitations of the channel pore. This approach has successfully demonstrated that MscL can allow passage of molecules with diameters up to 25 Å .

  • Bioactive molecule delivery: Functional assays using specific bioactive molecules like phalloidin (a bi-cyclic peptide that binds to actin filaments) can confirm successful transport through MscL pores into target cells .

  • Controlled activation methods: For precise experimental control, researchers can employ charge-induced activation methods, whereby specific modifications to the channel allow for chemical triggering of the pore opening independent of mechanical stress .

A comprehensive characterization typically combines these approaches to establish both the biophysical properties of the channel and its potential for molecular delivery applications.

What is the significance of the N-terminal domain in MscL function?

The N-terminal amphipathic helix of MscL plays a critical role in channel function through multiple mechanisms:

  • Stabilization of the closed state: The N-terminal domain interacts with both its own subunit and adjacent subunits to maintain the channel in a closed confirmation under resting conditions .

  • Force transduction: It serves as an essential mechanosensing entity that transduces membrane tension to the pore-lining TM1 helices. Finite element model analysis reveals high stress levels in this region during channel activation .

  • Coordinated gating: The N-terminus guides the tilting and movement of the five TM1 helices in a coordinated manner, magnifying the resulting pore expansion .

  • Cross-subunit interactions: EPR and MD simulations demonstrate essential interactions between the N-terminus and the TM2 helix of not only adjacent subunits but also the second subunit neighbor (i+2), defining the conformational freedom of the TM2 helix .

Experimental evidence supporting these roles includes:

  • Deletion studies showing significantly reduced channel sensitivity to membrane tension

  • Electrophysiological data demonstrating abrogated function in sequential N-terminal deletion constructs

  • Hypo-osmotic downshock experiments confirming functional impairment

How does the glycine hinge (G14) affect MscL gating properties?

The glycine residue at position 14 (G14) functions as a critical hinge between the N-terminal helix and the pore-lining TM1 helix . This structural feature exhibits several important characteristics:

  • Positioning effect: G14 positions the N-terminal helix parallel to the membrane plane at the bilayer-solvent interface .

  • Gating impact: Deletion of G14 results in a "leaky" phenotype with continuous spontaneous activity at subconducting levels, indicating its essential role in stabilizing the closed state .

  • Flexibility requirement: Site-directed mutagenesis studies replacing G14 with less flexible amino acids demonstrate altered gating properties, confirming that the structural flexibility at this position is crucial for proper channel function .

The mechanism appears to involve G14 allowing the necessary conformational rearrangement that establishes continuity between the N-terminus and TM1 during gating, enabling effective force transduction from the membrane to the channel pore .

How does Methylobacterium chloromethanicum MscL compare to other bacterial MscL channels?

While the search results don't provide direct comparative data specific to Methylobacterium chloromethanicum MscL versus other bacterial homologs, several important contextual points can be made:

  • Taxonomic considerations: Phylogenetic analysis based on 16S rDNA sequences has shown that Methylobacterium chloromethanicum exhibits extremely high similarity (100%) with Methylobacterium extorquens, suggesting their MscL channels may have very similar properties .

  • General conservation: MscL channels are highly conserved across bacterial species in terms of their basic pentameric structure and mechanosensing function, though specific sequence variations exist .

  • Functional homology: Despite sequence differences, the basic gating mechanism involving N-terminal contributions to tension sensing appears to be a blueprint for bilayer-mediated mechanosensation across different bacterial species .

Research examining detailed structural and functional differences between Methylobacterium chloromethanicum MscL and other bacterial homologs would require specific comparative studies that are not described in the available search results.

What is the relationship between Methylobacterium species classification and MscL research?

Taxonomic research has significant implications for MscL studies across Methylobacterium species:

  • Reclassification impact: Phylogenetic analysis has demonstrated that Methylobacterium chloromethanicum should be regarded as a synonym of Methylobacterium extorquens based on extremely high 16S rDNA sequence similarity (100%) .

  • Strain identification concerns: Ribotyping analysis and phylogenetic studies have revealed that many Methylobacterium strains, including some type specimens, have been erroneously identified in the past .

  • Experimental considerations: When conducting research on MscL from Methylobacterium species, researchers should be aware of these taxonomic relationships to properly interpret comparative results and ensure accurate attribution of functional properties .

Scientists working with Methylobacterium chloromethanicum MscL should consult current taxonomic literature to ensure proper classification and strain verification when designing experiments and interpreting results.

How can recombinant MscL be utilized for controlled delivery of molecules into cells?

Recombinant MscL offers significant potential for controlled molecular delivery applications due to its large pore size and controllable gating properties. Implementation strategies include:

  • Expression in target cells: Functional MscL can be expressed in mammalian cells while preserving its mechanosensitive properties, allowing tension-induced uptake of membrane-impermeable molecules .

  • Controlled activation: Researchers have developed methods for charge-induced activation of MscL, permitting precise control over when the channel opens independent of mechanical stimuli .

  • Size-selective transport: Studies have demonstrated that MscL can transport molecules up to approximately 25 Å in diameter, making it suitable for delivery of various bioactive compounds including:

    • Fluorescent markers and indicators

    • Small peptides

    • Specific cellular markers like phalloidin

The potential advantages of this approach include temporal control over delivery, minimal cellular disruption compared to other permeabilization methods, and the ability to deliver membrane-impermeable compounds without the need for chemical modifications or carrier systems .

What are the challenges in using MscL for biotechnological applications?

Despite its promise, several challenges must be addressed when developing MscL-based technologies:

  • Expression efficiency: Optimizing the expression of functional recombinant MscL in various cell types while minimizing potential toxicity from membrane disruption.

  • Activation control: Developing reliable methods to trigger channel opening only when desired and preventing spontaneous activation.

  • Selectivity engineering: While MscL has a large pore diameter, modifying the channel to enhance selectivity for specific target molecules without losing function remains challenging.

  • Stability considerations: Ensuring proper folding and membrane insertion across different expression systems and maintaining channel stability during purification and reconstitution processes.

  • Scale-up limitations: Moving from proof-of-concept studies to practical applications requires addressing issues related to consistency, reproducibility, and efficiency of the delivery system .

What biophysical techniques provide the most insight into MscL structure and dynamics?

Multiple complementary biophysical approaches have proven valuable for investigating MscL structure and dynamics:

  • Electron Paramagnetic Resonance (EPR) spectroscopy: This technique has been instrumental in elucidating the interactions between the N-terminal domain and adjacent protein regions, revealing essential cross-subunit contacts that define conformational freedom .

  • Molecular Dynamics (MD) simulations: MD approaches have provided detailed insights into the dynamic behavior of MscL during gating, including the movement of specific domains and their interactions with the lipid bilayer .

  • Finite Element (FE) modeling: While lacking the atomistic resolution of MD simulations, FE models allow investigation of larger timescales and provide a structural framework for understanding gating mechanisms at the continuum level. FE simulations have successfully reproduced key features of MscL gating including pore expansion, TM tilting, and membrane thinning .

  • Transmission Electron Microscopy (TEM): While not directly mentioned for MscL, TEM has been used to visualize cellular structures in Methylobacterium research and could potentially provide structural insights when combined with appropriate sample preparation techniques .

These methods have collectively contributed to our current understanding of how force is transmitted from the lipid bilayer to initiate MscL gating.

How should researchers design mutagenesis studies to investigate MscL function?

When designing mutagenesis studies for MscL research, several strategic approaches should be considered:

  • Targeted domain analysis: Focus on key structural elements such as:

    • The N-terminal amphipathic helix

    • The glycine hinge (G14)

    • Transmembrane domains TM1 and TM2

    • Inter-subunit interaction sites

  • Conservative substitutions: Begin with conservative amino acid replacements that maintain similar physicochemical properties to assess subtle functional effects before introducing more disruptive changes.

  • Functional assessment methods:

    • Electrophysiological characterization to directly measure channel activity

    • Hypo-osmotic downshock experiments to assess channel function in cellular contexts

    • Molecular uptake assays to evaluate pore formation and molecular transport capability

  • Cross-species comparative approach: Utilize sequence differences between MscL homologs from different Methylobacterium species or other bacteria to identify functionally important residues.

  • Complementary computational analysis: Pair experimental mutagenesis with computational modeling to predict and interpret functional outcomes of specific mutations .

The G14 hinge region provides an instructive example—its deletion resulted in a distinctive "leaky" phenotype with continuous spontaneous activity at subconducting levels, demonstrating how targeted mutagenesis can reveal critical functional roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.