Recombinant Methylobacterium chloromethanicum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; Mchl_2630; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-616
Protein Length
full length protein
Species
Methylobacterium extorquens (strain CM4 / NCIMB 13688) (Methylobacterium chloromethanicum)
Target Names
yidC
Target Protein Sequence
MGNDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQAAQTGAPQTADGIPSPSPR EGSPNAPAPGTLPGAAAQGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYH ETVSDESPRIVLLSPTGSANPYYAEFGWVGANAGPLPNADTLWKADGDLLAPGRPLTLTW DNGQGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQTQGYYVLHEGL IGVLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPF TGAFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNRINAYEREFGIKQF DLMIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMK AVQPEMTSIRERYKDDRVKQQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITI EMRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMNP APPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDN LRGMFKRGNKSAAAKG
Uniprot No.

Target Background

Function

Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It plays a role in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it assists in the folding of multispanning membrane proteins.

Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental role in bacterial systems?

YidC is a membrane insertase belonging to the Oxa1 superfamily that plays an essential role in bacterial inner membrane biogenesis. It significantly influences membrane protein composition and lipid organization within the bacterial cell membrane . The protein functions through a hydrophobic slide primarily composed of transmembrane segments TM3 and TM5, which serve as the major substrate contact site for inserting newly synthesized proteins into the membrane . YidC operates both independently as an insertase and in conjunction with the Sec translocon, where it aids in the proper folding of multi-pass membrane proteins . Additionally, YidC has been identified as having lipid scramblase activity, contributing to the organization of the membrane bilayer beyond its protein insertion function .

What key domains constitute YidC and how do they contribute to its function?

YidC contains several critical structural elements that enable its insertase function:

What are the most effective methods for studying YidC-substrate interactions?

Several complementary approaches have proven effective for investigating YidC-substrate interactions:

  • Site-directed mutagenesis: Systematic mutation of residues in the hydrophobic slide (particularly in TM3, TM4, and TM5) allows identification of critical substrate contact points. A quintuple serine mutant (5S) with mutations at residues 430, 435, 468, 505, and 509 has been particularly informative in understanding substrate specificity .

  • In vivo complementation assays: These assays utilize bacterial strains like E. coli MK6 with an arabinose-inducible promoter controlling chromosomal yidC expression. By depleting chromosomal YidC and expressing plasmid-encoded variants, researchers can assess the functional impact of specific mutations .

  • Pulse-labeling experiments: These are used to track the insertion and processing of YidC substrates, such as M13 procoat, to evaluate the effect of YidC mutations on substrate processing .

  • Proximity-dependent biotin labeling (BioID): This technique has successfully identified interacting partners like YibN within the YidC protein environment .

  • Affinity purification-mass spectrometry: This approach provides confirmation of protein-protein interactions in native membranes .

  • On-gel binding assays: Using purified proteins, these assays offer direct evidence of physical interactions between YidC and potential binding partners .

How can researchers effectively express and purify recombinant YidC for structural and functional studies?

While the search results don't provide a detailed protocol specific to Methylobacterium chloromethanicum YidC purification, they suggest approaches that have been successful with other bacterial YidC proteins:

  • Expression system: Plasmid systems like pGZ119EH carrying the yidC gene under an IPTG-inducible promoter have been used successfully .

  • Affinity tagging: His-tagged YidC constructs facilitate purification using Ni-NTA agarose beads, as demonstrated in SILAC-labeling experiments .

  • Membrane solubilization: Detergents such as n-dodecyl-β-D-maltoside (DDM) have been used to solubilize membrane fractions containing YidC .

  • Quality control: Assessing purified protein via functional complementation assays provides validation of proper folding and activity.

For researchers working specifically with Methylobacterium chloromethanicum, adapting these approaches while considering species-specific optimization might be necessary to achieve high-yield, functionally active protein.

What computational methods reveal insights into YidC structure-function relationships?

Several computational approaches have provided valuable insights into YidC dynamics and function:

  • Molecular dynamics simulations: Extended simulations (up to 1 microsecond) have been performed on various YidC constructs to understand domain interactions and protein stability .

  • Principal Component Analysis (PCA): This technique effectively distinguishes between wild-type YidC and variant systems, revealing the most significant conformational differences .

  • Dynamic Network Analysis (DNA): This approach analyzes associated motions of protein atoms, particularly useful for understanding how different domains communicate .

  • Correlation matrix analysis: Calculating correlation coefficients for the motion of Cα atoms helps quantify differences between wild-type and mutant YidC structures .

These computational approaches complement experimental data and provide atomic-level insights into how YidC domains interact and respond to substrate binding.

How do mutations in the hydrophobic slide affect YidC's substrate specificity?

Mutations in YidC's hydrophobic slide produce substrate-specific effects, revealing important insights about insertion mechanisms. The quintuple serine mutant (YidC-5S) with mutations at residues 430, 435, 468, 505, and 509 displays a fascinating substrate discrimination pattern:

  • Differential effects on substrates:

    • Inhibits insertion of subunit a of the FoF1 ATP synthase

    • Has no effect on the insertion of Sec-independent M13 procoat protein

    • Does not impact insertion of the C-tail protein SciP

  • Sec interaction dependency:

    • YidC-5S shows inhibited interaction with SecY

    • Fluorescently labeled YidC-5S failed to approach SecYEG when co-reconstituted in proteoliposomes, unlike wild-type YidC

This pattern suggests that the hydrophobic slide mutations specifically disrupt Sec-dependent insertion pathways while preserving Sec-independent functions. This demonstrates that YidC employs different molecular mechanisms for different substrate classes, with the hydrophobic slide playing a crucial role in communication with the Sec translocon .

What is the significance of YidC-YibN interaction in membrane protein biogenesis?

Recent research has identified YibN as a crucial physical and functional interactor of YidC with significant implications for membrane protein biogenesis:

  • Identification methods:

    • YibN was discovered through proximity-dependent biotin labeling (BioID)

    • The interaction was confirmed by affinity purification-mass spectrometry on native membranes

    • Further validation came from on-gel binding assays with purified proteins

  • Functional significance:

    • YibN enhances production and membrane insertion of YidC substrates including:

      • M13 and Pf3 phage coat proteins

      • ATP synthase subunit c

      • Various small membrane proteins like SecG

  • Impact on membrane organization:

    • YibN overproduction stimulates membrane lipid production

    • Promotes inner membrane proliferation

    • Potentially interferes with YidC lipid scramblase activity

These findings position YibN as a critical regulatory partner that influences both YidC's insertase function and its role in membrane lipid organization, revealing a previously unrecognized layer of regulation in bacterial membrane biogenesis.

How does the periplasmic domain contribute to YidC function in gram-negative bacteria?

The periplasmic domain (PD) present in gram-negative bacterial YidC but absent in gram-positive bacterial homologs plays important roles in protein stability and function:

Understanding the precise role of the PD remains an active area of research, with implications for developing targeted antibiotics that exploit structural differences between gram-positive and gram-negative bacterial insertion machinery.

What experimental systems are most suitable for studying YidC function in vivo?

Several experimental systems have proven valuable for investigating YidC function in living cells:

  • Conditional depletion strains:

    • E. coli MK6 strain with chromosomal YidC under arabinose-inducible promoter control

    • Growth on glucose medium depletes native YidC, allowing phenotypic assessment of plasmid-expressed variants

  • Complementation assays:

    • Serial dilution plating on selective media

    • Assessment of colony formation under YidC depletion conditions

  • Substrate tracking systems:

    • Pulse-labeling of YidC-dependent substrates like M13 procoat

    • Monitoring processing (e.g., cleavage to coat protein) as indicator of successful insertion

  • SILAC labeling:

    • Differential isotope labeling (e.g., Lys4/Lys0 lysine isotopologues)

    • Enables quantitative assessment of protein interactions via mass spectrometry

These systems provide complementary approaches to studying different aspects of YidC function, from broad phenotypic effects to specific substrate interactions.

What protein engineering approaches have advanced our understanding of YidC function?

Several protein engineering strategies have yielded significant insights into YidC function:

  • Systematic mutagenesis:

    • Targeted mutations in the hydrophobic slide (TM3, TM4, TM5)

    • Creation of the informative YidC-5S quintuple serine mutant

  • Domain deletion constructs:

    • YidC without PD region (YidC ΔPD)

    • YidC without C2 loop (YidC ΔC2)

    • YidC without both PD and C2 loop (YidC ΔPD ΔC2)

  • Fluorescent labeling:

    • Modification with fluorescent tags to track localization and protein-protein interactions

    • Used to demonstrate failed approach of YidC-5S to SecYEG in proteoliposomes

  • His-tagging:

    • Addition of histidine tags for affinity purification

    • Enables pull-down experiments to identify interacting partners

  • Proximity labeling adaptations:

    • BioID fusion constructs for identifying proteins in close proximity to YidC in vivo

These engineering approaches, particularly when combined with structural information, have been instrumental in dissecting the complex relationships between YidC domains and their functions.

What reconstitution systems best replicate natural YidC function in vitro?

While information about reconstitution systems is limited in the search results, several approaches are mentioned:

  • Proteoliposome reconstitution:

    • Co-reconstitution of purified YidC with SecYEG in proteoliposomes

    • Allows assessment of direct interactions between these components

  • In vitro translation-insertion systems:

    • Assessment of YidC-mediated insertion using purified components

    • Evaluation of substrate insertion efficiency with wild-type versus mutant YidC

  • Lipid composition considerations:

    • Given YidC's lipid scramblase activity, reconstitution systems that properly mimic bacterial membrane lipid composition are critical

    • YibN's effect on membrane lipid production suggests that lipid composition may regulate YidC function

For researchers studying Methylobacterium chloromethanicum YidC specifically, adapting these systems while considering the native lipid environment would be important for obtaining physiologically relevant results.

What are the key unresolved questions regarding YidC mechanism?

Despite significant advances in YidC research, several fundamental questions remain unresolved:

  • Substrate recognition specificity:

    • How does YidC discriminate between different substrate classes?

    • What specific sequence or structural features determine Sec-dependent versus Sec-independent insertion?

  • Mechanistic details of insertion:

    • How exactly does the hydrophobic slide facilitate membrane insertion?

    • What conformational changes occur during the insertion process?

  • Dual functionality:

    • How does YidC balance its insertase and lipid scramblase activities?

    • How are these functions regulated in response to cellular conditions?

  • Species-specific adaptations:

    • How do YidC homologs in different bacterial species, including Methylobacterium chloromethanicum, differ functionally?

    • What evolutionary pressures drive these adaptations?

Addressing these questions will require integrating structural, biochemical, computational, and cellular approaches to build a comprehensive model of YidC function.

How might targeting YidC lead to novel antimicrobial strategies?

The essential nature of YidC for bacterial viability makes it an attractive target for antimicrobial development:

  • Structural distinctions between species:

    • The presence of a periplasmic domain in gram-negative but not gram-positive bacteria offers potential for selective targeting

    • Differences in the hydrophobic slide composition may allow species-specific inhibitors

  • Disruption of YidC-interactor networks:

    • Compounds that disrupt specific interactions, such as YidC-YibN or YidC-SecY, might selectively inhibit bacterial growth

    • The 5S mutant's inability to interact with SecY suggests potential binding sites for inhibitors

  • Inhibition of substrate-specific insertion:

    • Targeting insertion of essential substrates like ATP synthase components could provide selective toxicity

    • The substrate specificity displayed by YidC-5S suggests distinct binding modes that could be exploited

  • Combination approaches:

    • Simultaneous targeting of YidC and interacting partners might provide synergistic antimicrobial effects

    • Combined YidC/Sec pathway inhibition might overcome redundancy in insertion mechanisms

Further structural and functional characterization of YidC from diverse bacterial species, including pathogens, will be critical for realizing its potential as an antimicrobial target.

What emerging technologies might advance YidC research?

Several cutting-edge technologies hold promise for deepening our understanding of YidC biology:

  • Cryo-electron microscopy:

    • Capturing YidC in different functional states during substrate insertion

    • Visualizing complexes with interacting partners like YibN and SecY

  • Advanced simulation approaches:

    • Extended molecular dynamics simulations on specialized computing platforms like Anton2

    • Integration of experimental constraints with simulation to model insertion mechanisms

  • Single-molecule techniques:

    • Fluorescence approaches to track individual insertion events

    • Force measurements to quantify energetics of YidC-mediated insertion

  • In-cell structural biology:

    • Techniques that probe YidC structure and interactions in native cellular environments

    • Methods that capture dynamic changes during substrate insertion

  • Systems biology integration:

    • Comprehensive mapping of YidC interaction networks across conditions

    • Understanding how YidC function coordinates with broader cellular processes

These technologies, particularly when applied in combination, promise to reveal new insights into the complex biology of membrane protein insertion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.