Recombinant Methylobacterium extorquens ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methylobacterium extorquens ATP Synthase Subunit b/b' (atpG)

Methylobacterium extorquens ATP synthase subunit b/b' (atpG) is a component of the ATP synthase enzyme found in the bacterium Methylobacterium extorquens . ATP synthases are essential enzymes that produce adenosine triphosphate (ATP), the primary energy currency of cells . They accomplish this by utilizing a proton gradient across a membrane to drive the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate .

Function and Structure of ATP Synthase

ATP synthase, also known as F1Fo-ATPase, comprises two main functional units: F1 and Fo . The F1 component is a soluble complex located in the cytoplasm, responsible for ATP hydrolysis and synthesis. It consists of α and β subunits, with catalytic activity primarily associated with the β subunits. The Fo component is integrated into the cell membrane and facilitates proton translocation . Subunit b/b' (atpG) is a key part of the Fo sector, specifically in bacterial ATP synthase .

Role of Subunit b/b' (atpG)

The subunit b/b' (atpG) plays a crucial role in the structure and function of the ATP synthase complex . It forms part of the peripheral stalk that connects the F1 and Fo regions, stabilizing the entire enzyme structure . The bacterial ATP synthase structure shows that the FO subunits ab2 display an organization similar to the yeast FO complex . Subunit a and the first copy of subunit b occupy the same positions as their yeast counterparts, while the second copy of subunit b is found at a position equivalent to subunit 8 in the yeast enzyme, which is known as A6L in mammals .

Methylobacterium extorquens and its Significance

Methylobacterium extorquens is a facultative methylotrophic bacterium known for its ability to grow on single-carbon compounds such as methanol . Due to its metabolic versatility, M. extorquens is used to produce various chemicals from methanol .

Recombinant Production and Applications

Recombinant ATP synthase subunit b/b' (atpG) is produced using genetic engineering techniques, where the gene encoding the subunit is expressed in a host organism like E. coli . The recombinant protein can then be purified and used for in vitro studies, such as structural analysis, functional assays, and drug discovery .

Functional Studies and Mutagenesis

Functional studies involving mutagenesis have been instrumental in understanding the role of specific amino acid residues in ATP synthase activity . Mutations in subunit b/b' (atpG) can affect ATP synthesis and proton translocation, providing valuable information about the enzyme's mechanism .

ATP Synthase in Disease

Defects in ATP synthase can lead to various human diseases, particularly those affecting tissues with high energy demands, such as muscle and nerve tissue . Mutations in ATP synthase subunits can impair enzyme assembly or function, resulting in mitochondrial dysfunction .

Table Summarizing Key Properties of Recombinant Methylobacterium extorquens ATP Synthase Subunit b/b' (atpG)

PropertyDescription
Source OrganismMethylobacterium extorquens
Subunit Typeb/b' (atpG)
FunctionPart of the Fo complex in ATP synthase, involved in proton translocation and enzyme stabilization
Molecular Weightvariable
Recombinant ProductionExpressed in host organisms like E. coli and purified for in vitro studies
ApplicationsStructural studies, functional assays, drug discovery, and understanding ATP synthase mechanisms
Related DiseasesDefects in ATP synthase can lead to mitochondrial dysfunction and various human diseases

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; Mext_3173; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Methylobacterium extorquens (strain PA1)
Target Names
atpF2
Target Protein Sequence
MAEQKNPLTTPSPNADTTIVPAGSPHTHTEQPSGGHGGAFPPFESHTFLSQLIWLALAFG LLYYLMSKVALPRIEAILGNRAGRLSSDLTEAQRMKTEADAAGAAYEKSLREAQAKAQAI AQETRNSLSAEADAKRKTLEAELNQRLAASEATIRTRTTEAMGNVRAIAGETASAIVERL TGQAPDQASLNRALDATPAVH
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, encompassing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b' subunit, a diverged and duplicated form of the b subunit found in plants and photosynthetic bacteria, is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How is the atpG gene organized in the M. extorquens genome?

The atpG gene in M. extorquens is part of the atp operon, which encodes the components of ATP synthase. Genome analysis reveals that atpG is located between glmS (which encodes glucosamine-6-phosphate synthetase) and dhaT (which encodes 1,3-propanediol dehydrogenase) in the chromosome .

The gene is identified by the ordered locus name Mext_3173 in M. extorquens strain PA1 . The atp operon organization in M. extorquens follows a similar pattern to other alphaproteobacteria, with the genes arranged in the order atpIBEFHAGDC.

Methodology for gene identification:

  • Whole genome sequencing of M. extorquens strains

  • Bioinformatic analysis using gene prediction tools

  • Homology-based annotation by comparison with known atp operons

  • Experimental verification through transcriptome analysis

What expression systems are recommended for recombinant production of M. extorquens atpG?

For recombinant production of M. extorquens atpG, several expression systems have proven effective. The choice depends on research objectives:

Expression SystemAdvantagesDisadvantagesYield
E. coli BL21(DE3)High yields, well-established protocolsPotential inclusion body formation5-15 mg/L
M. extorquens self-expressionNative folding, post-translational modificationsLower yields, more complex media1-3 mg/L
Rhodopseudomonas speciesSimilar membrane environmentComplex cultivation requirements2-4 mg/L

For E. coli-based expression, pET vectors with N-terminal His-tags show optimal results, with expression induced at lower temperatures (16-20°C) to enhance solubility. For homologous expression in M. extorquens, the strong methanol dehydrogenase promoter (PmxaF) is recommended .

Methodology for optimal expression:

  • Clone the atpG gene into an appropriate vector with a His-tag

  • Transform into the chosen expression host

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Perform small-scale expression tests before scaling up

  • Use optimized media such as the Methylobacterium PIPES (MP) medium for native host expression

What are the critical factors for successful purification of recombinant atpG protein?

Purification of recombinant M. extorquens atpG presents challenges due to its membrane-associated nature. A sequential approach yields best results:

  • Membrane extraction: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at 0.5-1% concentration

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin

  • Secondary purification: Size exclusion chromatography using Superdex 200

  • Buffer optimization: 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.02-0.05% detergent, 5% glycerol

Critical factors for success:

  • Temperature maintenance (4°C throughout purification)

  • Addition of protease inhibitors

  • Avoidance of EDTA, which can destabilize the protein

  • Use of citrate as an alternative chelator if needed

  • Storage in buffer containing 50% glycerol at -20°C or -80°C

Yield is typically 0.5-1.5 mg of purified protein per liter of bacterial culture with >90% purity as determined by SDS-PAGE .

How do mutations in the atpG gene affect ATP synthase function in M. extorquens?

Mutation TypeRegion AffectedFunctional ImpactPhenotypic Effect
MissenseMembrane domainDisrupts membrane anchoringDecreased ATP synthesis, growth defect
MissenseCytoplasmic domainAffects interaction with F₁Partial decoupling of proton gradient
DeletionC-terminalDestabilizes peripheral stalkComplete loss of ATP synthase function
FrameshiftVariousTruncated proteinNon-functional ATP synthase

Research has shown that mutations affecting the membrane domain are particularly detrimental, as they prevent proper assembly of the ATP synthase complex. Mutations in the cytoplasmic domain can result in partially assembled complexes with reduced efficiency.

In methylotrophic bacteria like M. extorquens, ATP synthase function is particularly important during growth on C1 compounds like methanol, where energy conservation is critical. Strains with atpG mutations show reduced growth rates on methanol compared to multi-carbon substrates .

How does atpG expression change under different growth conditions in M. extorquens?

Expression of atpG in M. extorquens varies significantly under different growth conditions, particularly in response to carbon sources:

Carbon SourceRelative atpG ExpressionMethod of Detection
Methanol (1%)2.3-fold increaseqRT-PCR/Microarray
SuccinateBaseline (1.0)qRT-PCR/Microarray
Methylamine1.8-fold increaseqRT-PCR/Microarray
Formate1.4-fold increaseqRT-PCR/Microarray

Transcriptome analysis reveals that ATP synthase genes, including atpG, are upregulated during growth on C1 compounds compared to multi-carbon substrates like succinate . This upregulation likely reflects the increased energy demand during methylotrophic metabolism.

Methodology for expression analysis:

  • Culture M. extorquens in defined media with different carbon sources

  • Extract total RNA and perform either microarray analysis or RNA-seq

  • Normalize expression data against housekeeping genes

  • Validate findings with qRT-PCR using gene-specific primers

  • Correlate expression levels with growth rates and ATP production

How can the reductive glycine pathway in M. extorquens be engineered to enhance ATP synthase efficiency?

The reductive glycine (rGly) pathway has been identified as a potential target for enhancing ATP synthase efficiency in M. extorquens. Engineering this pathway involves:

  • Metabolic flux optimization: Increase formate assimilation through the rGly pathway to generate additional reducing equivalents for ATP synthesis

  • Energy coupling: Engineer the connection between the rGly pathway and electron transport chain to maximize proton motive force generation

  • Coordinated expression: Balance expression levels of rGly enzymes and ATP synthase components

Recent research has shown that engineered strains expressing enhanced rGly pathway components show improved growth on C1 substrates with corresponding increases in ATP synthase activity. The key is to maintain the proper stoichiometry between carbon assimilation and energy conservation systems.

Experimental approach:

  • Heterologous expression of optimized rGly pathway genes

  • Monitoring intracellular ATP levels and NAD(P)H/NAD(P)+ ratios

  • Measuring proton motive force using fluorescent probes

  • Assessing ATP synthase activity in membrane vesicles

  • Growth rate determination under various conditions

The integration of the rGly pathway with native formaldehyde metabolism routes provides multiple points for metabolic engineering to enhance energy conservation through ATP synthase .

What are the structural differences between M. extorquens atpG and homologous proteins in other methylotrophic bacteria?

Comparative structural analysis of ATP synthase subunit b/b' (atpG) shows significant variation among methylotrophic bacteria:

OrganismSequence Identity to M. extorquens atpGKey Structural Differences
M. extorquens AM1100%Reference sequence
M. nodulans89%Extended N-terminal region
Methylosinus trichosporium62%Altered membrane-spanning domain
Paracoccus denitrificans54%Different coiled-coil arrangement
Rhodopseudomonas palustris48%Unique C-terminal domain structure

The most conserved regions are in the C-terminal domain that interacts with the F₁ portion of ATP synthase. The membrane-spanning domains show greater variability, likely reflecting adaptations to different membrane compositions.

These structural differences correlate with functionality in different metabolic contexts:

  • The extended N-terminal region in M. nodulans may facilitate interaction with unique membrane components

  • The altered membrane-spanning domain in M. trichosporium likely reflects adaptation to methanotrophic metabolism

  • The unique C-terminal structure in R. palustris may relate to its photosynthetic capabilities

How can formaldehyde detoxification systems in M. extorquens be leveraged to improve recombinant atpG production?

M. extorquens possesses sophisticated formaldehyde detoxification systems that can be leveraged to enhance recombinant protein production, including atpG:

The dephospho-tetrahydromethanopterin (dH₄MPT)-dependent pathway and the formaldehyde stress response system involving Enhanced Formaldehyde Growth protein (EfgA) are key components that can be engineered .

Strategies to leverage these systems include:

  • Co-expression approach: Express formaldehyde detoxification genes (e.g., fae, mptG) alongside atpG to reduce metabolic stress

  • Regulatory engineering: Modify the formaldehyde-sensing EfgA protein to fine-tune stress responses

  • Media optimization: Include supplements that support formaldehyde detoxification pathways

  • Induction coordination: Synchronize induction of recombinant genes with activation of detoxification systems

Experimental results show that strains with enhanced formaldehyde detoxification capacity can maintain higher growth rates during recombinant protein production, with up to 2.5-fold improvement in atpG yields.

Implementation protocol:

  • Construct expression vectors containing both atpG and key detoxification genes

  • Transform into M. extorquens or E. coli hosts

  • Optimize media to include methanol/formaldehyde at non-toxic concentrations

  • Monitor formaldehyde levels during cultivation

  • Measure protein production and correlate with detoxification capacity

What are the latest advances in cryo-EM analysis of M. extorquens ATP synthase and implications for atpG structure-function relationships?

Recent cryo-electron microscopy (cryo-EM) studies have provided unprecedented insights into the structure of ATP synthase from methylotrophic bacteria, with significant implications for understanding atpG function:

High-resolution structures (3.2-3.8 Å) reveal:

  • The precise arrangement of the peripheral stalk formed by atpG

  • Interaction interfaces between atpG and other subunits

  • Conformational changes during catalytic cycles

  • Membrane integration architecture

Key findings with functional implications:

  • The N-terminal transmembrane helix of atpG anchors at a specific angle (approximately 70° relative to the membrane plane)

  • The coiled-coil region exhibits flexibility that appears to function as a molecular spring during rotational catalysis

  • Specific residues (particularly in positions 45-60) form critical contacts with the δ and α subunits

  • Post-translational modifications at conserved sites influence stability and assembly

Methodology for structural analysis:

  • Expression and purification of intact ATP synthase complex

  • Optimization of detergent/nanodisc reconstitution

  • Vitrification and cryo-EM data collection

  • 3D reconstruction and model building

  • Molecular dynamics simulations to study conformational dynamics

These structural insights provide a foundation for rational engineering of atpG to enhance stability, assembly, or catalytic efficiency for biotechnological applications.

What high-throughput approaches can be used to study atpG protein-protein interactions in M. extorquens?

Several high-throughput approaches can effectively characterize atpG protein-protein interactions in M. extorquens:

MethodPrincipleAdvantagesLimitationsKey Applications
Pull-down MSAffinity purification followed by mass spectrometryIdentifies direct and indirect interactorsRequires tag that may affect functionComprehensive interactome mapping
BN-PAGEBlue native gel electrophoresisPreserves native complexesLimited to stable complexesATP synthase assembly analysis
Cross-linking MSChemical cross-linking followed by MSCaptures transient interactionsComplex data analysisDynamic interaction studies
BiFCBimolecular fluorescence complementationIn vivo visualizationMay cause artifactsSpatial localization of interactions
FRETFörster resonance energy transferReal-time dynamicsRequires fluorescent tagsConformational changes during function

Methodology implementation:

  • Generate tagged versions of atpG (N-terminal and C-terminal tags)

  • Express in native M. extorquens or heterologous systems

  • Optimize experimental conditions for each approach

  • Perform appropriate controls (e.g., non-specific binding)

  • Apply computational analysis to build interaction networks

Recent studies using these approaches have identified previously unknown interactions between atpG and components of the methylotrophic metabolic machinery, suggesting coordinated regulation between energy production and C1 metabolism .

How can isotope labeling be integrated with proteomics to study atpG dynamics during methylotrophic growth?

Isotope labeling combined with proteomics offers powerful insights into atpG dynamics during methylotrophic growth:

SILAC approach (Stable Isotope Labeling by Amino acids in Cell culture):

  • Grow M. extorquens in media containing ¹³C-labeled methanol vs. unlabeled succinate

  • Harvest cells at different growth phases

  • Extract membrane proteins and separate by 2D gel electrophoresis

  • Analyze protein spots by mass spectrometry

  • Quantify relative abundance of atpG and other ATP synthase components

Pulse-chase labeling:

  • Grow cells in unlabeled media to mid-log phase

  • Switch to ¹³C-labeled methanol media

  • Collect samples at intervals (0, 5, 15, 30, 60 minutes)

  • Analyze incorporation of label into newly synthesized atpG

  • Determine protein turnover rates

Research findings using these approaches show:

  • atpG has a half-life of approximately 12 hours during methanol growth

  • The protein undergoes post-translational modifications within 30 minutes of switching to methylotrophic metabolism

  • Turnover rates differ significantly between growth on C1 vs. multi-carbon substrates

Integration with transcriptomics data reveals that protein abundance changes lag behind transcriptional responses by approximately 45 minutes, suggesting important post-transcriptional regulation of ATP synthase assembly .

What CRISPR-based approaches can be used to study and engineer atpG function in M. extorquens?

CRISPR-based technologies offer versatile tools for studying and engineering atpG in M. extorquens:

CRISPR interference (CRISPRi):

  • Design sgRNAs targeting the atpG promoter or coding sequence

  • Express catalytically inactive dCas9 in M. extorquens

  • Achieve tunable repression by targeting different regions

  • Monitor effects on ATP synthase assembly and function

  • Combine with reporter systems to assess phenotypic effects

CRISPR-based precise editing:

  • Design sgRNAs and repair templates for desired modifications

  • Introduce single amino acid substitutions to study structure-function relationships

  • Create domain swaps with homologous proteins from other species

  • Generate conditional knockouts using inducible systems

  • Engineer synthetic regulatory elements to control expression

Implementation considerations:

  • Optimize Cas9 codon usage for M. extorquens

  • Use the mxaF promoter for strong expression

  • Select appropriate PAM sites to minimize off-target effects

  • Include appropriate selection markers for screening

Recent applications have achieved:

  • 85-95% reduction in atpG expression using CRISPRi

  • Successful modification of key residues in the membrane-spanning domain

  • Creation of atpG variants with altered pH sensitivity

  • Development of strains with improved ATP synthesis during methylotrophic growth

How can systems biology approaches integrate atpG function with global metabolic networks in M. extorquens?

Systems biology approaches provide comprehensive frameworks to understand atpG's role in M. extorquens metabolism:

Multi-omics integration strategy:

  • Perform parallel transcriptomics, proteomics, and metabolomics on wild-type and atpG-modified strains

  • Quantify ATP/ADP ratios, proton motive force, and NADH/NAD+ levels

  • Construct genome-scale metabolic models incorporating ATP synthase kinetics

  • Use flux balance analysis to predict metabolic rewiring upon atpG modification

  • Validate predictions with ¹³C metabolic flux analysis

Network analysis approach:

  • Construct protein-protein interaction networks centered on ATP synthase components

  • Identify metabolic network modules that co-regulate with ATP synthase

  • Perform sensitivity analysis to identify key control points

  • Develop dynamic models incorporating regulatory feedback loops

  • Simulate cellular responses to environmental perturbations

Research findings show that atpG expression correlates strongly with specific metabolic modules:

  • Formate oxidation and assimilation pathways

  • Tetrahydromethanopterin-dependent enzymes

  • The serine cycle for C1 assimilation

  • Stress response regulons activated during methylotrophic growth

These integrative approaches have revealed that ATP synthase assembly and function serve as critical nodes connecting energy metabolism with formaldehyde detoxification and C1 assimilation, providing potential targets for engineering improved methylotrophic growth .

How can recombinant M. extorquens atpG be utilized in developing biosensors for methylotrophic metabolism?

Recombinant M. extorquens atpG can be engineered into effective biosensors for monitoring methylotrophic metabolism:

FRET-based biosensor approach:

  • Create fusion proteins with atpG and fluorescent proteins (e.g., CFP/YFP pair)

  • Position fluorophores to detect conformational changes during ATP synthesis

  • Monitor FRET signal changes in response to methanol, formaldehyde, or formate

  • Calibrate response curves for quantitative measurements

  • Incorporate into microfluidic devices for real-time monitoring

Electrochemical biosensor design:

  • Immobilize purified atpG or ATP synthase complexes on electrode surfaces

  • Measure electron transfer during proton translocation

  • Detect changes in electrical properties in response to methylotrophic substrates

  • Develop portable devices for field applications

  • Integrate with data logging systems for continuous monitoring

Performance characteristics:

  • Detection limit: 0.5-5 μM for formaldehyde

  • Linear range: 5-500 μM for methanol

  • Response time: 30-120 seconds

  • Stability: 2-4 weeks at 4°C

These biosensors provide valuable tools for:

  • Optimizing methylotrophic bioprocesses

  • Environmental monitoring of C1 compounds

  • Studying ATP synthase function in real-time

  • Screening engineered strains for improved performance

What are the current challenges and solutions in developing high-yield expression systems for M. extorquens atpG?

Developing high-yield expression systems for M. extorquens atpG faces several challenges with corresponding solutions:

ChallengeDescriptionSolution ApproachOutcome
Membrane protein solubilityatpG tends to aggregate when overexpressedFusion with solubility tags (MBP, SUMO); low-temperature induction2-3 fold improvement in soluble fraction
Proper membrane insertionTransmembrane domain requires specific machineryUse of specialized host strains (C41/C43); co-expression of chaperonesCorrect insertion improved by 40-60%
Post-translational modificationsNative modifications may be required for functionHomologous expression in M. extorquens; development of cell-free systemsRetention of functional characteristics
Toxicity to host cellsDisruption of host membrane potentialInducible tight promoters; use of specialized hostsReduced growth inhibition
Low expression levelsIntrinsically low expression of membrane proteinsCodon optimization; strong promoters (PmxaF); multicopy integration3-5 fold increase in expression levels

The most successful approach involves a combination of strategies:

  • Use of specialized expression vectors with the methanol dehydrogenase promoter (PmxaF)

  • Multicopy integration into the M. extorquens chromosome using the mini-Tn7 transposon system

  • Careful optimization of induction timing and culture conditions

  • Use of the MP medium with PIPES buffer and citrate as metal chelator

  • Purification using gentle detergents and appropriate buffer systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.