Recombinant Methylobacterium extorquens Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methylobacterium extorquens Glycerol-3-Phosphate Acyltransferase (plsY)

Recombinant Methylobacterium extorquens glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme engineered for biochemical and biotechnological applications. It catalyzes the transfer of acyl groups from acyl-phosphate to glycerol-3-phosphate, a critical step in bacterial phospholipid biosynthesis. The enzyme is produced via recombinant expression in E. coli, with a His-tag for purification and stability. Its full-length sequence (1–202 amino acids) corresponds to the UniProt identifier A9W739, and it shares conserved structural motifs with homologs in other bacteria .

Biological Role in Phospholipid Biosynthesis

PlsY operates in the PlsX-Y pathway, a widespread bacterial mechanism for initiating phospholipid synthesis:

  1. PlsX converts acyl-acyl carrier protein (acyl-ACP) to acyl-phosphate.

  2. PlsY transfers the acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA).

  3. LPA acyltransferase adds a second acyl group to produce phosphatidic acid, a precursor for membrane phospholipids .

This pathway is essential for maintaining membrane integrity, particularly in methylotrophic bacteria like M. extorquens, which face oxidative stress during methanol metabolism .

Production and Purification of Recombinant PlsY

Recombinant PlsY is produced in E. coli with a His-tag for affinity chromatography. Key specifications include:

ParameterValue
SourceMethylobacterium extorquens AM1
Expression HostE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–202 amino acids)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionLyophilized powder dissolved in sterile water (0.1–1.0 mg/mL)

Notes: Avoid repeated freeze-thaw cycles. Aliquots with 50% glycerol are recommended for long-term storage at −20°C/−80°C .

Functional Studies

  • Mutagenesis:

    • Motif 1 Ser/Arg mutants abolish activity.

    • Motif 3 His/Asn mutants reduce catalytic efficiency, while Glu mutations destabilize the protein .

  • Inhibition: Noncompetitive inhibition by palmitoyl-CoA indicates allosteric regulation .

Applications in Biotechnological and Biochemical Studies

Recombinant PlsY is used to study:

  • Lipid biosynthesis pathways in methylotrophic bacteria, particularly under methanol-induced stress .

  • Membrane engineering to enhance stress resistance or modify lipid composition for biofuel production.

  • Enzyme kinetics and inhibitor screening, leveraging its conserved motifs and inhibition profiles .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
plsY; Mext_3314; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Methylobacterium extorquens (strain PA1)
Target Names
plsY
Target Protein Sequence
MTTLLAAGWPVLIAALVLGYACGAIPFGLILTKFAGLGDVRAIGSGNIGATNVLRTGRKG LAAATLLCDALKGTLPVLAASHWGEGPALAAGLGAFLGHLFPVWLGFKGGKGVATFIGVL LALSPVTLAAFAAIWLGLAFALKYSSLSALAASAATPLILWALGHGAVAALFLVLAALLW WKHAPNIRRLAAGTEGRIGKKG
Uniprot No.

Target Background

Function
Glycerol-3-phosphate acyltransferase (PlsY) from *Methylobacterium extorquens* catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.