Recombinant Methylobacterium extorquens Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Methylobacterium extorquens Large-Conductance Mechanosensitive Channel (MscL)

The large-conductance mechanosensitive channel (MscL) was the first mechanosensitive ion channel identified in bacteria . MscL opens its large pore when the turgor pressure of the cytoplasm increases .

Recombinant Methylobacterium extorquens MscL refers to the MscL protein derived from the bacterium Methylobacterium extorquens that has been produced using recombinant DNA technology . This involves isolating the gene encoding MscL from M. extorquens, cloning it into a suitable expression vector, and expressing it in a host organism to produce large quantities of the protein for research and industrial applications .

Production and Purification

The production of recombinant Methylobacterium extorquens MscL involves several steps:

  1. Gene Cloning: The mscL gene from Methylobacterium extorquens is amplified using PCR and then cloned into an expression vector .

  2. Expression: The recombinant vector is transformed into a host organism such as E. coli for protein production . The host cells are cultured under conditions that promote high-level expression of the MscL protein .

  3. Purification: The MscL protein is extracted from the host cells and purified using techniques such as affinity chromatography .

Research Findings and Applications

MscL has been extensively studied to understand its structure, function, and mechanism of activation. Research findings include:

  • Gating Mechanism: Studies have explored how MscL responds to mechanical stimuli at the molecular level. The "lipid moves first" model suggests that changes in lipid organization around the channel play a crucial role in its gating mechanism .

  • Modulation of MscL: Various chemical compounds can modulate MS channels through direct interactions with the protein, primarily targeting the MscL protein at the cytoplasmic-membrane interface close to the region of the transmembrane pockets . For example, dihydrostreptomycin (DHS) crosses the membrane primarily through MscL .

  • Spectroscopy: Pulsed electron-electron double resonance (PELDOR) spectroscopy assesses the correct folding of MscL when it is expressed in new strains designed for efficient membrane protein expression .

Table of MscL Properties

PropertyDescription
Protein NameLarge-conductance mechanosensitive channel
Gene NamemscL
OrganismMethylobacterium extorquens
Expression Region1-141 amino acids
Molecular WeightVaries depending on post-translational modifications and expression system.
FunctionMechanosensitive ion channel involved in osmoregulation.
AgonistsAgonists of MscL bind at the interface between the S1 and TM1 region of one subunit with the TM2 of another at the membrane-cytoplasmic interface .
Structure DeterminationX-ray crystallography, cryo-electron microscopy, and molecular dynamics simulations are used to determine MscL structure.
Purification TechniquesAffinity chromatography, size-exclusion chromatography.
ApplicationsPotential therapeutic applications, including drug delivery and development of new antibiotics. MscL can be used to study membrane protein structure and function, osmoregulation, and mechanotransduction. Useful in the development of microbial strains for industrial applications.

Future Directions

Further research on recombinant Methylobacterium extorquens MscL may focus on:

  • High-resolution Structural Studies: Determining the high-resolution structure of MscL in different states (closed, open, intermediate) to elucidate the gating mechanism .

  • Drug Development: Identifying compounds that can modulate MscL activity for potential therapeutic applications .

  • Biotechnological Applications: Engineering MscL to create biosensors or develop novel strategies for stress tolerance in industrial microorganisms .

  • Metabolic Engineering: M.extorquens can be engineered to produce terpenes, and further research is needed to increase carbon flow toward patchoulol .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Mext_2579; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Methylobacterium extorquens (strain PA1)
Target Names
mscL
Target Protein Sequence
MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAVTGGLDFSNYYIPLS SKVQDGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNVLKSREEAKPKPVA EVPADVKLLGEIRDLLAARRV
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should recombinant mscL protein be handled and stored for optimal stability?

Recombinant mscL protein typically comes as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE. For proper handling:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they degrade protein quality

  • For short-term use, working aliquots can be stored at 4°C for up to one week

What expression systems are most effective for producing recombinant M. extorquens mscL?

While E. coli is the most commonly used heterologous expression system for M. extorquens mscL protein production, homologous expression in M. extorquens itself offers unique advantages for certain applications. For homologous expression:

  • The mini-Tn7 transposon system enables high-level expression under the control of the strong M. extorquens AM1 methanol dehydrogenase promoter (PmxaF)

  • This approach allows stable maintenance and expression without antibiotic selective pressure

  • The system permits precise control of gene copy number (from 1-5 copies)

  • Integration occurs at a specific Tn7 attachment site (attTn7) located in an intergenic region between glmS and dhaT genes

  • This site-specific integration minimizes disruption of host gene function

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, well-established protocolsPotential improper foldingHigh
M. extorquensNative environment, proper foldingSlower growth, specialized mediaModerate

How can I optimize codon usage for heterologous expression of mscL in different host systems?

Codon optimization is critical for efficient heterologous expression of M. extorquens proteins:

  • Analyze the codon usage bias of your target expression system (E. coli or other hosts)

  • Modify the mscL gene sequence to match preferred codons while maintaining the amino acid sequence

  • Consider GC content and mRNA secondary structures that might impact translation efficiency

  • Remove rare codons that might cause translational pausing

  • For expression in M. extorquens itself, codon optimization may not be necessary, but expression can be enhanced by using the strong methanol dehydrogenase promoter (PmxaF)

Successful heterologous expression has been demonstrated in M. extorquens for various genes including beta-galactosidase (bgl), esterase (est), and green fluorescent protein (gfp), suggesting that similar approaches would work for mscL .

What are the optimal culture conditions for M. extorquens growth prior to protein expression?

M. extorquens requires specific culture conditions for optimal growth before protein expression:

  • Temperature: 30°C (not 37°C as with E. coli)

  • Agitation: 200 rpm in shaking cultures

  • Media: Minimal medium with appropriate carbon source

  • Carbon sources: methanol (124-240 mM), sodium acetate (5-30 mM), or disodium succinate (15 mM)

  • Culture vessel: 25 mL culture in 125 mL-serum bottles, loosely capped to allow gas exchange

  • Inoculation: Start with OD600 of 0.02 from a 2-day-old culture

  • Antibiotics (when selection is needed): kanamycin (10-20 μg/mL) or tetracycline (10-20 μg/mL)

For specific experiments, various minimal media formulations can be used, including:

  • MC medium (adapted from Zhu et al., 2016)

  • HM medium (adapted from Mokhtari-Hosseini et al., 2009)

  • CM medium (adapted from Choi et al., 1989)

How should I design experiments to study mscL channel gating mechanisms?

When investigating mscL channel gating mechanisms, consider the following experimental approach:

  • Patch-clamp electrophysiology:

    • Use giant spheroplasts or reconstituted proteoliposomes

    • Apply defined membrane tension using negative pressure

    • Measure single-channel conductance at different membrane tensions

    • Compare with known mechanosensitive channels like E. coli MscL

  • Reconstitution studies:

    • Purify His-tagged recombinant mscL using nickel affinity chromatography

    • Reconstitute into liposomes of defined lipid composition

    • Use fluorescent dye release assays to monitor channel opening

    • Systematically vary membrane composition to assess lipid-protein interactions

  • Mutagenesis experiments:

    • Generate point mutations at conserved residues

    • Express and purify mutant proteins

    • Compare gating thresholds and conductance properties

    • Correlate functional changes with structural predictions

  • Controls:

    • Empty liposomes (no protein)

    • Heat-denatured mscL protein

    • Well-characterized MscL channels from other species

How can site-directed mutagenesis be used to probe structure-function relationships in M. extorquens mscL?

Site-directed mutagenesis provides powerful insights into mscL structure-function relationships:

  • Key regions for targeted mutagenesis:

    • Transmembrane domains that form the channel pore

    • Residues involved in tension sensing (typically hydrophobic amino acids interfacing with lipids)

    • Cytoplasmic and periplasmic loops that may regulate gating

  • Mutagenesis workflow:

    • Design primers for PCR-based site-directed mutagenesis

    • Generate mutant constructs in expression vectors

    • Transform into E. coli for protein production

    • Purify using standard His-tag affinity chromatography

    • Validate protein folding using circular dichroism

  • Functional characterization:

    • Reconstitute mutant proteins in liposomes

    • Measure pressure thresholds for channel opening

    • Determine changes in conductance, gating kinetics, and ion selectivity

    • Compare with homology models based on crystallized MscL channels from other species

  • Data analysis approach:

    • Plot pressure-response curves to determine P50 (pressure for 50% activation)

    • Apply Boltzmann distribution analysis to determine energy differences in gating

    • Use molecular dynamics simulations to interpret experimental findings

What are the challenges in analyzing mscL function in native versus heterologous expression systems?

Researchers face several important challenges when comparing mscL function across expression systems:

  • Membrane composition differences:

    • M. extorquens membranes have distinct phospholipid profiles compared to E. coli

    • These differences can affect channel gating thresholds and kinetics

    • Solution: Characterize membrane compositions and reconstitute purified protein in defined lipid systems

  • Post-translational modifications:

    • Potential modifications in the native host may be absent in heterologous systems

    • These could affect channel regulation and interaction with other cellular components

    • Solution: Use mass spectrometry to identify and compare post-translational modifications

  • Protein-protein interactions:

    • Native interacting partners may be absent in heterologous systems

    • These interactions could modulate channel function

    • Solution: Perform pull-down assays to identify interaction partners in native membranes

  • Expression level variability:

    • The mini-Tn7 transposon system allows precise control of copy number (1-5 copies)

    • This enables systematic studies of expression level effects on channel function

    • Solution: Use the multicopy integration protocol to create isogenic strains with different expression levels

How should I analyze contradictory results when comparing M. extorquens mscL properties with other bacterial mechanosensitive channels?

When facing contradictory results in comparative studies:

  • Systematic methodology comparison:

    • Carefully evaluate differences in experimental conditions (buffer composition, pH, temperature)

    • Assess protein purification protocols for potential effects on activity

    • Consider membrane/lipid composition differences between studies

    • Evaluate expression system effects (E. coli vs. native expression)

  • Standardization approach:

    • Include a well-characterized control (e.g., E. coli MscL) in all experiments

    • Normalize results to this standard reference

    • Develop a standardized proteoliposome composition for cross-species comparisons

    • Use identical recording conditions for electrophysiology experiments

  • Resolution strategies for conflicting data:

    • Perform dose-response studies across a wide range of conditions

    • Use multiple independent techniques to measure the same property

    • Collaborate with labs reporting contradictory results to identify methodological differences

    • Consider sequence variations that might explain functional differences

What statistical approaches are most appropriate for analyzing mscL electrophysiological data?

For robust statistical analysis of mscL electrophysiological recordings:

What are the common pitfalls in purifying recombinant M. extorquens mscL and how can they be avoided?

Researchers frequently encounter these challenges when purifying mscL:

  • Low expression yield:

    • Cause: Toxicity to host cells, poor codon optimization, inclusion body formation

    • Solution: Optimize induction conditions (lower temperature, reduced inducer concentration), use specialized E. coli strains (C41/C43), verify codon optimization

  • Protein aggregation:

    • Cause: Insufficient detergent, inappropriate detergent choice, rapid detergent removal

    • Solution: Screen multiple detergents (DDM, LMNG, DMNG), add glycerol (10-20%) to all buffers, use gentle detergent exchange methods

  • Loss of activity:

    • Cause: Denaturation during purification, essential lipid removal, oxidation of critical residues

    • Solution: Maintain reducing conditions (add DTT/BME), include lipids in purification buffers, minimize exposure to extreme pH and temperature

  • Impurities after IMAC purification:

    • Cause: Non-specific binding to Ni-NTA, protein degradation, strong dimers/oligomers

    • Solution: Include low imidazole (10-20 mM) in wash buffers, add protease inhibitors, perform size exclusion chromatography as a polishing step

  • Reconstitution challenges:

    • Cause: Inefficient protein incorporation, liposome aggregation, detergent removal issues

    • Solution: Optimize protein:lipid ratios, use biobeads or dialysis for detergent removal, verify incorporation using freeze-fracture EM or density gradient centrifugation

How can I develop a reliable functional assay for M. extorquens mscL activity in reconstituted systems?

Designing robust functional assays requires careful consideration:

  • Fluorescent dye release assay:

    • Encapsulate self-quenching fluorescent dyes (calcein, carboxyfluorescein) in liposomes

    • Reconstitute purified mscL into these liposomes

    • Apply osmotic downshock or amphipaths to trigger channel opening

    • Monitor fluorescence dequenching as indicator of channel activity

    • Controls: Empty liposomes, liposomes with inactive mutant channels

  • Patch-clamp electrophysiology:

    • Form giant unilamellar vesicles (GUVs) containing reconstituted mscL

    • Apply negative pressure to patches in inside-out or outside-out configuration

    • Record single-channel currents at different membrane tensions

    • Analyze conductance, gating threshold, and kinetics

    • Controls: Patches from protein-free GUVs, known mechanosensitive channels

  • Ion flux assays:

    • Load liposomes with ions detectable by specific electrodes (K+, Na+, Ca2+)

    • Reconstitute mscL into these liposomes

    • Trigger channel opening and monitor ion efflux using ion-selective electrodes

    • Calculate channel activity from efflux rate

    • Controls: Ionophore-mediated complete ion release, detergent-disrupted liposomes

  • Stopped-flow spectroscopy:

    • Monitor rapid kinetics of mscL opening using fluorescent indicators

    • Apply defined pressure jumps using stopped-flow apparatus

    • Measure time-resolved fluorescence changes

    • Extract opening and closing rates

    • Controls: Pressure jumps with inactive channels, different rates of pressure application

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.