Recombinant Methylobacterium extorquens Methenyltetrahydrofolate cyclohydrolase (fchA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
fchA; MexAM1_META1p1729; Methenyltetrahydrofolate cyclohydrolase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
Target Names
fchA
Target Protein Sequence
MAGNETIETFLDGLASSAPTPGGGGAAAISGAMGAALVSMVCNLTIGKKKYVEVEADLKQ VLEKSEGLRRTLTGMIADDVEAFDAVMGAYGLPKNTDEEKAARAAKIQEALKTATDVPLA CCRVCREVIDLAEIVAEKGNLNVISDAGVAVLSAYAGLRSAALNVYVNAKGLDDRAFAEE RLKELEGLLAEAGALNERIYETVKSKVN
Uniprot No.

Target Background

Function

Essential for both C1 and C2 metabolism.

Database Links
Protein Families
Cyclodeaminase/cyclohydrolase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methenyltetrahydrofolate cyclohydrolase (fchA) and what role does it play in Methylobacterium extorquens metabolism?

Methenyltetrahydrofolate cyclohydrolase (fchA) is a critical enzyme in the C1 metabolism of Methylobacterium extorquens. It catalyzes the conversion of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate, playing an essential role in the organism's methylotrophic pathway. This enzyme is particularly important in formaldehyde metabolism, which is central to M. extorquens' ability to utilize methanol and other C1 compounds as carbon and energy sources.

During methylotrophic growth, M. extorquens produces formaldehyde as an intermediate metabolite, which at concentrations of approximately 1 mM can become toxic to the cells if not properly metabolized . The fchA enzyme functions within a network of formaldehyde-processing enzymes that help maintain cellular homeostasis during growth on C1 compounds.

How does fchA interact with other enzymes in the C1 metabolic pathway?

The fchA enzyme functions within an interconnected network of enzymes involved in formaldehyde metabolism and C1 transfer reactions. In Methylobacterium extorquens, formaldehyde is generated during methanol oxidation and must be efficiently metabolized to prevent toxicity. The pathway involving fchA connects with:

  • The tetrahydromethanopterin (H4MPT)-dependent pathway for formaldehyde oxidation

  • The tetrahydrofolate (H4F)-dependent pathway for C1 unit incorporation into biomass

During formaldehyde stress, the expression and activity of these enzymes must be carefully coordinated. Research shows that disruptions in this pathway can significantly impact the organism's ability to grow on methanol and other C1 compounds .

How does formaldehyde stress affect fchA expression and function in Methylobacterium extorquens?

When M. extorquens experiences formaldehyde stress, it initiates a complex transcriptional response to mitigate toxicity. While the direct effect on fchA expression is not fully characterized in the provided references, research on the global transcriptional response to formaldehyde stress provides valuable context.

M. extorquens possesses sophisticated mechanisms to handle formaldehyde stress, including the formaldehyde sensor EfgA, which halts translation in response to elevated formaldehyde levels . This translational arrest appears to be a protective mechanism against proteotoxicity. The relationship between this response and fchA function is an important area of investigation.

In wild-type M. extorquens exposed to formaldehyde, cells enter a quiescent state that is metabolically active but non-replicating. This state is reversible when formaldehyde levels decrease. Without protective mechanisms like EfgA, cells show delayed responses to formaldehyde and exhibit signs of proteotoxic and genotoxic stress .

What experimental design approaches are most effective for studying fchA function?

When designing experiments to investigate fchA function in Methylobacterium extorquens, researchers should consider using factorial experimental designs to efficiently examine multiple variables simultaneously. As discussed in search result , factorial designs offer several advantages:

  • They allow examination of interactions between factors

  • They require fewer experimental subjects than comparable designs while maintaining statistical power

  • They provide more comprehensive data than single-factor experiments

Design TypeAdvantagesDisadvantagesWhen to Use
Complete FactorialExamines all possible interactionsRequires many experimental conditionsWhen resources permit and all factor combinations are biologically meaningful
Fractional FactorialEconomical; fewer conditions requiredSome effects are aliased (confounded)When resource limitations prevent complete factorial designs
Single FactorSimple to implement and analyzeLimited ability to detect interactionsFor preliminary studies or when interactions are not of interest
Individual ExperimentsFocused examination of each factorInefficient use of resources; may miss interactionsWhen factors cannot be manipulated simultaneously

For study of fchA specifically, a factorial design might examine factors such as:

  • Gene expression levels (wild-type vs. overexpression)

  • Growth substrates (succinate vs. methanol)

  • Formaldehyde concentration (control vs. stress conditions)

  • Genetic background (wild-type vs. ΔefgA strain)

This approach would maximize information yield while optimizing experimental resources .

How can researchers distinguish between direct and indirect effects of fchA mutations on formaldehyde metabolism?

Distinguishing between direct and indirect effects of fchA mutations requires a multi-faceted experimental approach:

  • Transcriptomic Analysis: Compare the global transcriptional response to formaldehyde stress between wild-type and fchA mutant strains. This can reveal whether fchA mutations trigger compensatory changes in expression of other genes involved in formaldehyde metabolism.

  • Metabolic Flux Analysis: Track the flow of carbon through metabolic pathways using isotope-labeled substrates to determine how fchA mutations alter metabolic flux distributions.

  • Suppressor Mutation Screening: Identify secondary mutations that restore growth or formaldehyde tolerance in fchA mutants, which can reveal functional relationships between fchA and other genes.

  • Protein-Protein Interaction Studies: Investigate whether fchA physically interacts with other enzymes or regulatory proteins in the formaldehyde metabolic network.

  • Complementation Experiments: Express wild-type fchA in mutant backgrounds to determine which phenotypes are directly attributable to fchA function.

When interpreting results, researchers should consider the temporal dynamics of the response, as formaldehyde stress in M. extorquens triggers a rapid but reversible transition to a quiescent state that is distinct from responses to other stressors like antibiotics .

What are the optimal conditions for expressing and purifying recombinant Methylobacterium extorquens fchA?

Based on available information about recombinant M. extorquens fchA protein, the following methodology is recommended:

Expression System:

  • Host: E. coli expression system

  • Construct: Full-length fchA (amino acids 1-208) with N-terminal His-tag

  • Vector: Expression vector with strong inducible promoter (e.g., T7)

Purification Protocol:

  • Harvest cells and lyse using appropriate buffer (typically Tris-based)

  • Clarify lysate by centrifugation

  • Purify using Ni-NTA affinity chromatography

  • Elute with imidazole gradient

  • Dialyze against storage buffer (Tris/PBS-based buffer, pH 8.0)

  • Add trehalose (6% final concentration) as a stabilizing agent

  • Lyophilize if long-term storage is needed

Storage Conditions:

  • Store lyophilized powder at -20°C/-80°C

  • For reconstituted protein, add glycerol (5-50% final concentration)

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Guidelines:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to 50% final concentration

What assays can be used to measure fchA enzymatic activity in vitro and in vivo?

Several complementary approaches can be employed to assess fchA enzymatic activity:

In Vitro Assays:

  • Spectrophotometric Assays: Monitor the conversion of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate by measuring absorbance changes at 350 nm.

  • Coupled Enzyme Assays: Link fchA activity to the production or consumption of NAD(P)H, which can be monitored spectrophotometrically.

  • HPLC Analysis: Quantify substrate consumption and product formation using separation techniques coupled with UV detection.

In Vivo Approaches:

  • Growth Phenotyping: Compare growth rates of wild-type and fchA mutant strains on various carbon sources, particularly C1 compounds.

  • Formaldehyde Sensitivity Tests: Evaluate tolerance to exogenous formaldehyde in wild-type versus fchA mutant strains.

  • Metabolic Labeling: Track the fate of labeled carbon sources using techniques such as 13C-labeling and metabolomics.

  • Reporter Gene Fusions: Construct transcriptional or translational fusions to monitor fchA expression under different conditions.

When conducting these assays, researchers should consider the potential crosstalk between different formaldehyde metabolism pathways and the impact of cellular stress responses on experimental outcomes.

How can researchers design effective experiments to study fchA in the context of formaldehyde stress?

When investigating fchA function during formaldehyde stress, researchers should design experiments that account for the complex and dynamic nature of the stress response. Based on available research on M. extorquens stress responses , the following experimental design considerations are recommended:

Key Experimental Variables:

  • Formaldehyde Concentration: Use concentrations that induce stress without causing cell death (~5 mM has been used in published protocols) .

  • Temporal Sampling: Include multiple time points (e.g., minutes, hours, days) to capture both immediate and adaptive responses.

  • Growth Phase: Start experiments with cells in a defined growth phase, as sensitivity to formaldehyde may vary.

  • Carbon Source: Compare cells grown on methanol versus multi-carbon substrates like succinate (3.5-15 mM) .

Experimental Controls:

  • Strain Controls: Include both wild-type and relevant mutant strains (e.g., ΔefgA) for comparison .

  • Stress Controls: Compare formaldehyde stress to other translational inhibitors like kanamycin (50 μg/mL) to distinguish stress-specific responses .

  • Media Controls: Use defined media like Methylobacterium PIPES (MP) medium to ensure reproducible results .

Analytical Approaches:

  • Growth Measurements: Monitor optical density to track growth arrest and recovery.

  • Transcriptomic Analysis: Use RNA-seq to capture global changes in gene expression.

  • Proteomic Analysis: Monitor changes in protein levels and modifications.

  • Metabolomic Analysis: Track changes in key metabolites, particularly formaldehyde and related compounds.

When interpreting results, researchers should consider that approximately 70% of the global response to formaldehyde in M. extorquens is mediated by EfgA, suggesting that experiments in both wild-type and ΔefgA backgrounds are necessary for comprehensive understanding .

How can fchA research contribute to biotechnological applications of Methylobacterium extorquens?

Understanding fchA function has significant implications for developing M. extorquens as a biotechnological platform:

  • Methanol-Based Bioprocessing: M. extorquens can utilize methanol as a carbon source, making it attractive for conversion of C1 feedstocks into value-added products. Enhancing fchA function could improve methanol utilization efficiency.

  • Formaldehyde Detoxification Systems: Knowledge of formaldehyde metabolism in M. extorquens could inform development of bioremediation strategies for environments contaminated with formaldehyde.

  • Synthetic Biology Applications: Engineering fchA and related enzymes could create strains with enhanced tolerance to formaldehyde and other toxic intermediates, expanding the potential applications of methylotrophic bacteria.

  • Biosensors for Formaldehyde Detection: Understanding the interplay between fchA and formaldehyde sensing mechanisms like EfgA could lead to development of whole-cell biosensors for environmental monitoring.

Research into the interplay between fchA and stress response mechanisms like EfgA-mediated translational arrest may provide insights into designing more robust microbial cell factories for biotechnological applications .

What is the relationship between fchA and the EfgA-mediated formaldehyde stress response?

The relationship between fchA and the EfgA-mediated formaldehyde stress response represents an important research frontier:

EfgA has been identified as a formaldehyde sensor that halts translation in response to elevated formaldehyde levels, triggering a quiescent state that protects cells from formaldehyde toxicity . The working model suggests that EfgA binds formaldehyde directly and arrests translation to prevent cellular damage, particularly proteotoxicity.

Research questions that should be explored include:

  • Does translational arrest via EfgA affect fchA expression and activity during formaldehyde stress?

  • Does fchA contribute to the cell's ability to metabolize formaldehyde during recovery from EfgA-mediated quiescence?

  • How do mutations in fchA affect the threshold for EfgA activation and the kinetics of the formaldehyde stress response?

Comparative studies of wild-type and ΔefgA strains exposed to formaldehyde have shown that EfgA mediates approximately 70% of the observed global response to formaldehyde. In the absence of EfgA, M. extorquens exhibits a delayed and muted response to formaldehyde and shows signs of proteotoxic and genotoxic stress . Understanding how fchA functions within this context could provide insights into formaldehyde metabolism under stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.