Recombinant Methylobacterium extorquens Methylamine utilization protein mauE (mauE)

Shipped with Ice Packs
In Stock

Description

Genetic Context and Functional Role

MauE is encoded within the mau gene cluster (mauFBEDACJGLMN), which is essential for methylamine catabolism. Key findings include:

  • MADH Assembly: MauE facilitates the maturation of MADH, a periplasmic enzyme converting methylamine to formaldehyde and ammonium. Mutants lacking mauE fail to produce the MADH small subunit (MauA) and show reduced levels of the large subunit (MauB) .

  • Membrane Association: MauE contains four predicted transmembrane helices, suggesting roles in protein translocation or cofactor insertion .

  • Cross-Species Complementation: mauE from Paracoccus denitrificans restores MADH activity in M. extorquens mutants, confirming functional conservation .

Research Findings on MauE Mutants

Studies using mauE knockout strains reveal its indispensable role:

Phenotype ObservedImplication
Loss of MADH small subunitMauE is required for MauA stability or post-translational modification
Reduced MADH large subunitIndirect destabilization suggests coordinated assembly mechanisms
Normal amicyanin levelsMauE specifically impacts MADH, not other mau cluster products like MauC

These results highlight MauE’s role in early-stage MADH biogenesis, potentially mediating disulfide bond formation or subunit interactions .

Industrial and Metabolic Engineering Applications

Recombinant MauE supports advancements in:

  • Methanol Biorefining: Engineered M. extorquens strains with enhanced formaldehyde tolerance (via metY mutations) show improved biomass yield on methanol . MauE’s role in formaldehyde production links it to strain optimization.

  • Lignin Valorization: Engineered strains metabolizing methoxylated aromatics (e.g., vanillate) rely on formaldehyde detoxification pathways involving MauE .

  • Heterologous Expression Systems: Rhodobacter sphaeroides expressing mauE alongside other mau genes produces functional MADH, enabling biochemical studies without native regulatory constraints .

Future Directions

Ongoing research focuses on:

  • Structural Resolution: Cryo-EM or X-ray crystallography to map MauE’s interaction sites with MADH subunits.

  • Synthetic Biology: Leveraging mauE in modular pathways for C1 compound conversion to biofuels.

  • Stress Response Networks: Transcriptomic data suggest MauE-linked processes upregulate chaperones/proteases under methanol stress, warranting mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mauE; MexAM1_META1p2771; Methylamine utilization protein MauE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
Target Names
mauE
Target Protein Sequence
MIMALLAEPVVTTFVRAFLILLLASAAIPKLRHGEEFFGVVRNFRLMPEWLARPFALVLP WLELGIAVGLVLPVTAPLAAGLAGGLMVLFGIAIAINVARGRTAIDCGCFRNGMKQKLSW LLVGRNAGLALAAFGLAWLLPVAPAAGPFDLAIGFAAAGLTMLLIYGASLLSGLQSGARS SQLSKG
Uniprot No.

Target Background

Function
This protein may be specifically involved in the processing, transport, and/or maturation of the MADH beta-subunit.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MauE protein in Methylobacterium extorquens and what is its role in methylamine metabolism?

MauE is a membrane protein that plays an essential role in methylamine metabolism in methylotrophic bacteria. Based on structural predictions and functional studies, MauE is characterized as a membrane protein with five transmembrane-spanning helices . While its precise molecular function remains under investigation, evidence strongly suggests MauE is involved in the processing, transport, and/or maturation of the beta-subunit of methylamine dehydrogenase (MADH) .

Research in Paracoccus denitrificans, a related methylotroph, has shown that mauE mutants are unable to grow on methylamine while maintaining normal growth on other C1 compounds . These mutants contain normal levels of amicyanin (the natural electron acceptor for MADH) but show undetectable levels of the MADH beta-subunit and reduced levels of the alpha-subunit, indicating MauE's critical role in MADH assembly and function .

How is the mauE gene organized within the methylamine utilization gene cluster?

The mauE gene is positioned within a well-organized 5.2-kb gene cluster dedicated to methylamine utilization in M. extorquens AM1 . Genetic analysis reveals that mauE is located immediately downstream of mauB (which encodes the MADH large subunit) and upstream of mauD . This organization suggests a coordinated expression of these genes, which is consistent with their functional relationship in the methylamine utilization pathway.

Table 1: Organization of the mau gene cluster in M. extorquens AM1

GeneProductApproximate SizePosition in ClusterFunction
mauBMADH large subunit~45 kDaUpstream of mauECatalytic subunit of methylamine dehydrogenase
mauEMembrane protein~23 kDaBetween mauB and mauDProcessing/maturation of MADH beta-subunit
mauDSoluble protein~23 kDaBetween mauE and mauAProcessing/maturation of MADH beta-subunit
mauAMADH small subunit~13-18.5 kDaDownstream of mauDStructural component of methylamine dehydrogenase

What molecular techniques are effective for studying mauE function in M. extorquens?

Studying mauE function requires a multi-faceted approach combining genetic, biochemical, and molecular biology techniques:

  • Gene knockout and complementation: Creating mauE deletion mutants followed by complementation with wildtype or mutated versions can reveal functional domains and essential residues . When generating knockouts, it's critical to ensure mutations don't disrupt downstream gene expression through polar effects.

  • Expression systems: The T7 expression system in E. coli has been successfully used to express mau genes for initial characterization . For MauE specifically, membrane protein expression systems like C41/C43 E. coli strains with appropriate detergents are recommended due to its transmembrane nature.

  • Growth phenotype analysis: Comparing growth kinetics on methylamine versus other carbon sources (e.g., methanol, succinate) between wildtype and mauE mutants provides functional insights .

  • Protein localization: Fluorescent protein fusions or epitope tagging combined with cellular fractionation can determine subcellular localization, though care must be taken to ensure tags don't disrupt the transmembrane topology.

  • Transcriptomic analysis: RNA-seq or microarray analysis comparing gene expression patterns between wildtype and mutant strains under various growth conditions can reveal regulatory networks .

How do mauE mutants affect growth on different carbon sources?

Based on studies in related methylotrophs like Paracoccus denitrificans, mauE mutants display a characteristic growth phenotype :

  • Complete growth deficiency on methylamine: mauE mutants are unable to grow when methylamine is provided as the sole carbon and energy source .

  • Normal growth on alternative C1 compounds: Despite the methylamine utilization defect, mauE mutants maintain normal growth on other C1 compounds such as methanol . This differential response highlights the specificity of MauE for the methylamine utilization pathway.

  • Normal growth on multi-carbon compounds: Growth on substrates like succinate remains unaffected in mauE mutants, as these compounds are metabolized through separate pathways .

This distinctive growth pattern serves as a phenotypic signature for confirming mauE mutations and helps distinguish MauE's specific role from broader methylotrophic functions.

What are the structural characteristics of the MauE protein and how do they relate to its function?

MauE is predicted to contain five transmembrane-spanning helices, classifying it as an integral membrane protein . This membrane topology is highly significant for understanding its function:

  • Topological organization: Secondary structure analyses suggest MauE adopts a configuration with both periplasmic and cytoplasmic domains connected by transmembrane segments . This organization is consistent with a role in transporting components across the membrane or facilitating protein assembly at the membrane interface.

  • Conserved motifs: Comparative analysis with homologous proteins from other methylotrophs may reveal conserved sequence motifs essential for function. While specific conserved motifs in MauE have not been fully characterized in the available data, this represents an important avenue for future research.

  • Structure-function relationship: The membrane localization of MauE supports its proposed role in the transport and/or processing of MADH subunits, particularly the beta-subunit which contains the catalytic cofactor tryptophan tryptophylquinone (TTQ) .

A comprehensive structural characterization of MauE would require techniques such as X-ray crystallography or cryo-electron microscopy, which remain challenging for membrane proteins and represent an important frontier in MauE research.

How does MauE interact with other components of the methylamine utilization pathway?

MauE appears to function within a complex network of interactions involved in MADH assembly and function:

  • MauD interaction: Given their sequential arrangement in the genome and shared phenotypes when mutated, MauE likely works in concert with MauD . Both proteins appear essential for the processing, transport, and/or maturation of the MADH beta-subunit .

  • MADH subunit processing: The significant reduction of MADH beta-subunit in mauE mutants suggests a direct or indirect interaction critical for beta-subunit stability and function . This interaction may be part of a quality control mechanism that prevents the accumulation of non-functional MADH components.

  • Cofactor incorporation: MauE may participate in the biosynthesis or incorporation of the TTQ cofactor in the MADH beta-subunit, which is essential for catalytic activity.

Research approaches to characterize these interactions include co-immunoprecipitation, bacterial two-hybrid systems, and in vitro reconstitution experiments with purified components.

What are the challenges in expressing recombinant MauE for structural studies?

Expressing recombinant MauE for structural and functional studies presents several significant challenges:

  • Membrane protein solubilization: As a transmembrane protein, MauE requires appropriate detergents or lipid environments for extraction from membranes while maintaining native folding . This necessitates extensive optimization of solubilization conditions.

  • Expression system selection: Heterologous expression of membrane proteins often results in toxicity or inclusion body formation. Testing multiple expression systems (E. coli, yeast, insect cells) with different promoters, fusion tags, and growth conditions is essential for obtaining functional protein.

  • Protein stability: Once extracted from membranes, MauE may exhibit limited stability, complicating purification and characterization efforts. Stabilizing mutations, fusion partners, or nanodiscs/amphipols may be necessary to maintain structural integrity.

  • Functional validation: Confirming that recombinant MauE retains native function is challenging due to the complexity of its natural context. Complementation assays with mauE mutants and reconstitution experiments are valuable approaches for validation.

  • Crystallization barriers: If X-ray crystallography is pursued, the hydrophobic nature of membrane proteins presents additional complications for crystal formation, often requiring extensive screening and optimization.

How does the function of MauE in M. extorquens compare to homologous proteins in other methylotrophic bacteria?

Comparative analysis of MauE across different methylotrophic species reveals both conservation and specialization:

  • Sequence conservation: The MauE protein shows significant sequence similarity between related methylotrophs like Paracoccus denitrificans and Methylobacterium extorquens, suggesting conserved functional elements across these organisms .

  • Functional equivalence: Studies in P. denitrificans have provided much of our understanding about MauE function, with findings that appear applicable to M. extorquens based on genetic similarities . Both organisms show similar phenotypes when mauE is disrupted, indicating functional conservation.

  • Species-specific adaptations: Despite core functional conservation, sequence variations in MauE proteins may reflect adaptations to different ecological niches and metabolic contexts. These variations could influence substrate specificity, regulatory mechanisms, or interaction partners.

  • Methylobacterium-specific features: The genus Methylobacterium has adapted to utilize a wide range of C1 compounds in various environmental contexts, potentially leading to specialized features in MauE function compared to other methylotrophs.

Phylogenetic analysis combined with functional complementation studies across species boundaries would provide valuable insights into both conserved and species-specific aspects of MauE function.

What are the optimal conditions for heterologous expression of recombinant MauE?

Successful expression of recombinant MauE requires careful optimization of multiple parameters:

  • Expression system selection:

    • E. coli C41/C43 strains: Specifically designed for membrane protein expression

    • Methylotrophic yeast (e.g., Pichia pastoris): Can provide a more native-like membrane environment

    • Cell-free expression systems: Allow direct incorporation into nanodiscs or liposomes

  • Vector design considerations:

    • Include a cleavable affinity tag (His6, GST, or MBP) for purification

    • Consider a fusion partner that enhances folding (e.g., GFP to monitor folding and expression levels)

    • Optimize codon usage for the expression host

    • Use a tunable promoter to control expression rate

  • Expression conditions:

    • Lower temperature (16-20°C) to slow folding and reduce inclusion body formation

    • Reduced inducer concentration (e.g., 0.1-0.5 mM IPTG for E. coli systems)

    • Extended expression time (24-48 hours)

    • Addition of specific lipids or membrane-mimetic compounds to the culture medium

  • Extraction and purification:

    • Screen multiple detergents (DDM, LDAO, etc.) for optimal solubilization

    • Consider nanodiscs or amphipols for maintaining protein stability

    • Use size exclusion chromatography to confirm monomeric state vs. aggregation

  • Functional validation:

    • Circular dichroism to confirm secondary structure

    • Complementation assays in mauE mutants to verify activity

Each of these parameters should be systematically optimized to achieve sufficient quantities of functional recombinant MauE protein.

How can protein-protein interactions between MauE and other methylamine utilization proteins be studied?

Investigating MauE's interactions with other components of the methylamine utilization pathway requires multiple complementary approaches:

  • Genetic interaction studies:

    • Double knockout/knockdown experiments to identify synthetic phenotypes

    • Suppressor screens to identify compensatory mutations

    • Site-directed mutagenesis targeting predicted interaction interfaces

  • In vivo interaction approaches:

    • Bacterial two-hybrid assays adapted for membrane proteins

    • Split-GFP complementation assays for visualizing interactions

    • In vivo crosslinking followed by co-immunoprecipitation

    • FRET/BRET assays using fluorescent protein fusions

  • In vitro interaction studies:

    • Co-purification/pull-down assays with recombinant proteins

    • Surface plasmon resonance or microscale thermophoresis for binding kinetics

    • Reconstitution experiments in liposomes or nanodiscs

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Structural approaches:

    • Cryo-electron microscopy of protein complexes

    • X-ray crystallography of co-crystallized components

    • NMR studies of interactions with soluble domains

When designing these experiments, it's critical to consider MauE's membrane localization and ensure that experimental conditions maintain the native membrane environment or provide suitable alternatives.

What strategies can be used to improve the stability of recombinant MauE for in vitro studies?

Enhancing the stability of recombinant MauE for structural and functional studies requires a multi-faceted approach:

  • Lipid environment optimization:

    • Screen different lipid compositions to identify stabilizing conditions

    • Reconstitute in nanodiscs with defined lipid compositions

    • Test lipid-like detergents (e.g., CHAPSO, GDN) that better mimic native membrane

  • Protein engineering approaches:

    • Identify and remove flexible regions that may promote aggregation

    • Introduce disulfide bonds to stabilize tertiary structure

    • Create fusion constructs with well-behaved proteins (e.g., T4 lysozyme)

    • Perform alanine scanning to identify destabilizing residues

  • Buffer optimization:

    • Systematic screening of pH, ionic strength, and buffer components

    • Addition of specific ligands or substrates that induce stable conformations

    • Inclusion of osmolytes (glycerol, sucrose) to prevent aggregation

    • Testing of various stabilizing additives (e.g., cholesterol hemisuccinate)

  • Advanced stabilization techniques:

    • Thermostability assays to guide optimization efforts

    • Conformational stabilization through antibody fragments or nanobodies

    • Selection of thermostable variants through directed evolution approaches

Combining these strategies through systematic screening will maximize the chances of obtaining stable, functional recombinant MauE suitable for detailed biochemical and structural characterization.

How can transcriptomic data be used to understand mauE regulation under different growth conditions?

Transcriptomic analysis provides powerful insights into mauE regulation and function within the broader metabolic network:

  • Experimental design considerations:

    • Compare expression profiles across multiple carbon sources (methylamine, methanol, succinate)

    • Include time-course analyses during adaptation to new carbon sources

    • Examine expression under stress conditions (e.g., formaldehyde stress )

    • Compare wildtype and regulatory mutant strains

  • Data analysis approaches:

    • Differential expression analysis to identify co-regulated genes

    • Cluster analysis to group genes with similar expression patterns

    • Motif discovery in promoter regions to identify regulatory elements

    • Network analysis to position mauE within regulatory hierarchies

  • Integration with other data types:

    • Correlate transcriptomic data with proteomic and metabolomic profiles

    • Link expression changes to growth phenotypes

    • Identify potential post-transcriptional regulation through RNA-seq

    • Validate key findings with targeted methods (qRT-PCR, reporter fusions)

  • Biological interpretation strategies:

    • Map expression patterns to metabolic pathways

    • Identify regulatory cascades controlling mauE expression

    • Distinguish direct vs. indirect effects through time-resolved data

    • Compare with related methylotrophic bacteria to identify conserved regulatory patterns

Understanding how mauE responds to different conditions at the transcriptional level can provide insights into its role within the methylamine utilization pathway and its integration with broader metabolic networks.

What statistical approaches are recommended for analyzing mauE mutant phenotypes?

Rigorous statistical analysis is essential for accurately characterizing mauE mutant phenotypes:

  • Growth curve analysis:

    • Fit growth data to mathematical models (exponential, Gompertz, etc.)

    • Compare growth parameters (lag phase, doubling time, maximum OD)

    • Use repeated measures ANOVA for time-course data

    • Apply non-linear mixed effects models for biological replicates

  • Multi-condition comparisons:

    • Two-way ANOVA to assess interaction between genotype and growth condition

    • Post-hoc tests with appropriate corrections for multiple comparisons

    • Principal component analysis to identify major sources of variation

    • Multidimensional scaling to visualize similarity between conditions

  • Omics data analysis:

    • Control for false discovery rate in high-dimensional data

    • Implement appropriate normalization methods for the data type

    • Use gene set enrichment analysis for pathway-level effects

    • Apply Bayesian methods to integrate prior knowledge

  • Reproducibility and validation:

    • Power analysis to determine appropriate sample sizes

    • Leave-one-out validation for predictive models

    • Bootstrap methods to estimate confidence intervals

    • Meta-analysis approaches when comparing across studies

When analyzing mauE phenotypes, it's particularly important to consider the multivariate nature of bacterial growth and metabolism, rather than focusing on isolated parameters.

How can contradictory data about MauE function be reconciled?

Researchers may encounter seemingly contradictory findings regarding MauE function, requiring careful analytical approaches to reconcile:

  • Systematic review of methodological differences:

    • Compare experimental conditions (media composition, growth phase, temperature)

    • Assess genetic background variations between studies

    • Evaluate methodological differences in protein preparation or assays

    • Consider species-specific differences if comparing across organisms

  • Hypothesis testing for reconciliation:

    • Design experiments specifically testing competing hypotheses

    • Use orthogonal approaches to measure the same phenomenon

    • Implement factorial designs to identify interacting variables

    • Conduct dose-response or time-course experiments to identify non-linear effects

  • Integration of multiple data types:

    • Combine genetic, biochemical, and structural data for holistic interpretation

    • Use computational modeling to test whether contradictory data can be explained by complex dynamics

    • Apply Bayesian inference to update models as new evidence emerges

    • Develop testable predictions that would distinguish between competing models

  • Biological complexity considerations:

    • Evaluate whether MauE has multiple functions depending on context

    • Consider potential post-translational modifications affecting function

    • Assess whether different protein complexes form under different conditions

    • Examine potential regulatory feedback loops creating context-dependent behavior

By systematically addressing sources of apparent contradictions, researchers can develop more nuanced and accurate models of MauE function that accommodate seemingly discrepant observations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.