Recombinant Methylobacterium extorquens Methylamine utilization protein mauF (mauF)

Shipped with Ice Packs
In Stock

Description

Introduction to Methylamine Utilization in Methylobacterium extorquens

Methylobacterium extorquens AM1 is a facultative methylotroph capable of metabolizing single-carbon (C1) and multicarbon compounds, including methylamine . The methylamine utilization (mau) gene cluster is critical for converting methylamine into assimilable intermediates via the enzyme methylamine dehydrogenase (MADH) . Within this cluster, mauF encodes a membrane-associated protein essential for MADH biosynthesis and function .

Genetic Organization of the mau Gene Cluster

The mau cluster in M. extorquens AM1 consists of 11 genes (mauFBEDACJGLMN), all transcribed in the same orientation . Key features include:

GeneFunction/CharacteristicsLocalization Prediction
mauFEncodes a membrane-associated protein with four transmembrane helices .Membrane-associated
mauBEncodes the large subunit of MADH .Periplasmic (with leader peptide)
mauAEncodes the small subunit of MADH .Periplasmic (with leader peptide)
mauCEncodes amicyanin, an electron carrier .Periplasmic

The mauF gene is positioned upstream of mauB and is co-transcribed with other mau genes under methylamine-inducing conditions .

Role and Characteristics of MauF Protein

MauF is a critical component for MADH assembly and activity:

  • Structural Role: MauF is required for the stability of the MADH small subunit (mauA) and influences the abundance of the large subunit (mauB) .

  • Membrane Association: Predicted to contain four transmembrane helices, MauF likely facilitates protein transport or cofactor insertion .

  • Mutational Impact: mauF mutants lack functional MADH activity and fail to grow on methylamine as a sole carbon source .

Functional Insights from Mutational Studies

MutationPhenotypeReference
ΔmauFLoss of MADH small subunit; reduced large subunit levels; no growth on methylamine .
ΔmauGMADH present but non-functional; defects in tryptophan tryptophylquinone (TTQ) synthesis .

These findings highlight MauF’s role in stabilizing MADH subunits and ensuring proper enzyme assembly .

Comparative Analysis with Other Methylotrophs

The mau cluster varies across methylotrophs:

  • Methylophilus methylotrophus W3A1: Lacks mauC and mauJ but retains mauFBEDAGLM; mauF complements M. extorquens mutants .

  • Paracoccus denitrificans: Requires mauFBEDACJG for heterologous MADH activity, mirroring M. extorquens .

Applications and Future Research Directions

  • Biotechnological Potential: Recombinant MauF could enable engineered methylotrophs for industrial C1 compound conversion .

  • Unresolved Questions:

    • Precise mechanistic role of MauF in MADH assembly.

    • Structural characterization of MauF to clarify its interaction with other mau gene products.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we will fulfill any specific format requests you provide during order placement. Please ensure you clearly indicate your desired format in the order notes. We will prepare your product accordingly.
Lead Time
Delivery timelines may vary based on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping practice includes blue ice packs. Should you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a 6-month shelf life at -20°C/-80°C. Lyophilized forms typically have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
mauF; MexAM1_META1p2769; Methylamine utilization protein MauF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
Target Names
mauF
Target Protein Sequence
MPTLTPPAGSEVIPFASVHTERVEDCLVFPSELSTKVRLGGLVTAVSGGILGAALLSQTS SQGVAVPALLMGLSFVGGLLSTWSPCGYSSLCLLRPVGPYSARSLVKYTPTFLLHGIGYA VGALILGCVLGIAGGLLGFGGVSFGALAGLGAAGIIYGAHQLGFLRVPYPQRRAQVPHDA RQRFPVWFIGGLYGLSLGLNYLTYVQTPILYLVTAAAVLSSNIGAAILLFAAFNAGRFLP MAVNYLPVSDITVQNWLARRQEGAALLDGVLLVAGGAALLTFAAL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the methylamine utilization (mau) gene cluster in Methylobacterium extorquens?

The methylamine utilization (mau) gene cluster in Methylobacterium extorquens AM1 encodes proteins responsible for the oxidation of methylamine. Based on sequence comparisons with other methylotrophic bacteria, the mau gene cluster typically contains multiple open reading frames organized in a specific order. In M. extorquens AM1, these genes include mauFBEDAGLM, which show considerable sequence identity with Mau polypeptides from other methylotrophic bacteria . The gene organization follows a conserved pattern across related methylotrophic species, though with some variations. For instance, while the mau gene cluster in Methylophilus methylotrophus W3A1 contains eight open reading frames identified as mauFBEDAGLM, it lacks two genes (mauC and mauJ) that are found between mauA and mauG in other studied mau gene clusters .

What is the specific role of MauF in methylamine metabolism?

MauF is a component of the methylamine utilization system in M. extorquens and other methylotrophic bacteria. While the exact function of MauF has not been fully elucidated in the provided search results, studies on mau mutants in related organisms provide insights into its potential role. In Methylobacillus flagellatum KT, mauF mutants are unable to grow on methylamine as a carbon source and lack methylamine dehydrogenase activity, although they still synthesize both the large and small subunit polypeptides of methylamine dehydrogenase . This suggests that MauF plays a crucial role in the functional assembly or activity of methylamine dehydrogenase rather than in the synthesis of the enzyme subunits themselves.

How does M. extorquens compare to other methylotrophic bacteria in terms of amine metabolism?

Methylobacterium extorquens appears to possess multiple systems for C1 compound utilization. Unlike some other methylotrophic bacteria, M. extorquens AM1 has two distinct types of methanol dehydrogenase (MeDH) enzymes for methanol oxidation: MxaFI-MeDH, which requires pyrroloquinoline quinone (PQQ) and Ca in its active site, and XoxF-MeDH, which requires PQQ and lanthanides such as Ce and La . For methylamine utilization, M. extorquens AM1 has systems similar to Methylobacillus flagellatum KT, as both possess methylamine dehydrogenase systems for amine oxidation. This is in contrast to Methylophilus methylotrophus W3A1-NS, which lacks an additional methylamine dehydrogenase system for amine oxidation beyond the primary mau system .

What are the recommended approaches for cloning and expressing recombinant MauF?

Based on studies with related methylotrophic bacteria, successful cloning and expression of recombinant MauF would involve:

  • Promoter selection: A study with Methylophilus methylotrophus W3A1-NS identified a promoter upstream of mauF that was used to construct an expression vector (pAYC229) . When working with M. extorquens, researchers should consider using either this native promoter or a well-characterized promoter appropriate for methylotrophic bacteria.

  • Vector construction: The entire mauF gene, including its regulatory elements, should be amplified using PCR with primers designed based on the published sequences. For recombinant expression, insertion into a suitable expression vector that functions in either E. coli or other methylotrophic hosts is recommended.

  • Expression conditions: Since M. extorquens is known to preferentially utilize lanthanide-dependent enzymes when lanthanides are available , the expression medium should be carefully formulated depending on whether you want to promote expression of lanthanide-dependent or lanthanide-independent systems.

How can I design mutations to study MauF function?

To study MauF function through mutations, researchers should consider:

  • Targeted mutation approaches: Based on studies with M. flagellatum KT, where chemical mutagenesis identified functional mauF mutants , researchers could use site-directed mutagenesis to create specific amino acid substitutions in conserved regions of the protein.

  • Phenotypic screening: Mutations in mauF in M. flagellatum resulted in inability to grow on methylamine as a carbon source and lack of methylamine dehydrogenase activity, while still producing the enzyme subunits . Similar phenotypic screening could be applied to M. extorquens mauF mutants.

  • Complementation testing: Mutant phenotypes should be confirmed through complementation with the wild-type gene. In M. flagellatum, subclones of the mau gene cluster were used successfully for complementation of chemically induced mau mutants .

What methods are effective for assessing MauF activity?

Evaluation of MauF activity can be performed using several approaches:

  • Growth assays: Test the ability of wild-type and mutant strains to grow on methylamine as the sole carbon and/or nitrogen source. Methylamine utilization mutants in M. flagellatum KT showed distinct growth phenotypes depending on which mau gene was affected .

  • Enzyme activity assays: Measure methylamine dehydrogenase activity in cell extracts. Previous studies with mau mutants revealed that mauF mutants lack methylamine dehydrogenase activity despite synthesizing the enzyme subunits .

  • Protein expression analysis: Use Western blotting or mass spectrometry to detect the presence and levels of MauF and other Mau proteins. Whole-cell matrix-assisted laser desorption/ionization time-of-flight mass spectrometry analysis (WC-MS) has been applied to evaluate diversity in Methylobacterium species .

How do regulatory systems control mauF expression in M. extorquens?

The regulation of methylamine utilization genes in M. extorquens involves complex systems that may affect mauF expression:

  • Two-component regulatory systems: While specific information about mauF regulation is limited in the search results, research on methanol oxidation systems in M. extorquens AM1 has identified two two-component systems (MxcQE and MxbDM) and an additional response regulator (MxaB) that are required for expression of the mxa operon . Similar regulatory mechanisms might control mau gene expression.

  • Environmental sensing: M. extorquens AM1 actively senses and responds to lanthanide availability, preferentially utilizing lanthanide-dependent methanol dehydrogenases when possible . This suggests sophisticated environmental sensing mechanisms that might also influence methylamine utilization pathways.

  • Cross-regulation: The XoxF proteins in M. extorquens AM1 have been shown to be required for expression of mxaFI genes, suggesting cross-regulation between different C1 metabolism systems . Similar cross-regulation might exist between methanol and methylamine utilization systems.

What are the challenges in purifying active recombinant MauF protein?

Purification of active recombinant MauF protein presents several challenges:

  • Protein stability: Methylamine utilization proteins may form complexes or require specific cofactors for stability. For example, studies with XoxF1 from M. extorquens AM1 showed low methanol oxidation activity in vitro, with a Vmax of only 0.015 U/mg .

  • Expression host considerations: The choice of expression host can significantly impact the folding and activity of recombinant MauF. While E. coli is commonly used for heterologous protein expression, a methylotrophic host might provide a more suitable environment for proper folding and potential post-translational modifications.

  • Purification strategy: A multi-step purification approach is likely necessary, potentially including affinity chromatography if a tag is incorporated into the recombinant protein, followed by ion exchange and size exclusion chromatography to achieve high purity while maintaining activity.

How does MauF interact with other components of the methylamine utilization system?

Understanding the interactions between MauF and other Mau proteins is crucial for comprehending the complete methylamine utilization system:

  • Functional dependencies: Studies in M. flagellatum KT have shown that mutations in different mau genes result in similar phenotypes (inability to grow on methylamine as a carbon source and lack of methylamine dehydrogenase activity) , suggesting functional interdependence among Mau proteins.

  • Assembly pathway: The observation that mauF mutants synthesize methylamine dehydrogenase subunits but lack enzyme activity suggests that MauF may be involved in the assembly or activation of the enzyme complex rather than subunit synthesis.

  • Species-specific variations: The requirement for specific Mau proteins varies between species. For example, MauM is required for synthesis of functional methylamine dehydrogenase in M. flagellatum but not in M. extorquens AM1 or Paracoccus denitrificans , highlighting the importance of species-specific studies.

How do mau gene clusters vary across different methylotrophic bacteria?

The organization and content of mau gene clusters show both conservation and variation across methylotrophic bacteria:

  • Core genes: The core mau genes (mauFBEDAGLM) appear to be conserved across multiple methylotrophic species, including M. extorquens AM1, M. flagellatum KT, and M. methylotrophus W3A1 .

  • Variable components: Some differences exist in gene content and organization. For example, the mau gene cluster from M. methylotrophus W3A1 lacks the mauC (amicyanin) and mauJ genes that have been found between mauA and mauG in other studied mau gene clusters .

  • Regulatory elements: The presence and copy numbers of regulator genes vary among methylotrophic bacteria that contain both mxaF and xoxF homologs, making it difficult to define a general requirement and role for these regulators in methylotrophy .

What are potential applications of recombinant MauF in biotechnology research?

Recombinant MauF protein could have several applications in biotechnology:

  • Biocatalysis: As part of the methylamine utilization pathway, recombinant MauF might be employed in biocatalytic processes for the conversion of methylated amines, potentially useful in green chemistry applications.

  • Biosensors: Given the specificity of the methylamine utilization system, components like MauF could be incorporated into biosensors for detecting methylated compounds in environmental or industrial samples.

  • Expression systems: The identified promoter upstream of mauF used to construct the expression vector pAYC229 could be utilized in biotechnology for controlled expression of recombinant proteins in methylotrophic hosts.

How can differential expression analysis help understand MauF function in various growth conditions?

Differential expression analysis can provide insights into MauF function:

  • Condition-dependent expression: By comparing mauF expression levels under different growth conditions (varying carbon sources, nitrogen sources, and presence of lanthanides), researchers can determine the specific environmental triggers for mauF expression.

  • Regulatory network mapping: Correlating the expression patterns of mauF with other genes involved in C1 metabolism can help map the regulatory networks controlling methylamine utilization. This approach would be similar to studies that revealed the role of XoxF in regulating mxaFI expression in M. extorquens AM1 .

  • Comparative transcriptomics: Comparing transcriptional responses across different methylotrophic bacteria can identify conserved and species-specific aspects of mauF regulation and function, providing a broader evolutionary context for understanding methylamine utilization systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.