Recombinant Methylobacterium extorquens Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
kdpC; Mext_0235; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Methylobacterium extorquens (strain PA1)
Target Names
kdpC
Target Protein Sequence
MLNQLRPALVLLVALTAVTGLAYPLAVTGIAGALFPAKAAGSLIERDGRIIGSSLIGQSF TGEGYFHGRPSATNAADPADASKTVPAPYNAASSAGSNLGPTSAALAERVKGDLAALKAE NPGRPVPVDLVTTSGSGLDPDISPEAALFQVPRIARARNLPEARLRDLVAGQVQGRTLGL LGEPRVNVLALNLVLDDLAKR
Uniprot No.

Target Background

Function
The Recombinant *Methylobacterium extorquens* Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Potassium-transporting ATPase C chain (kdpC) in Methylobacterium extorquens?

The kdpC protein is a critical component of the potassium-transporting ATPase complex in Methylobacterium extorquens. It functions as the C chain of the ATP phosphohydrolase enzyme (EC 3.6.3.12) that facilitates potassium binding and translocation across the cell membrane . In Methylobacterium extorquens, the kdpC gene is identified as Mext_0235 and produces a protein that plays an essential role in potassium homeostasis, which is particularly important for osmotic regulation and cellular metabolism .

How is recombinant Methylobacterium extorquens kdpC typically expressed and purified?

Recombinant Methylobacterium extorquens kdpC is typically expressed using prokaryotic expression systems, with E. coli being the most common host organism . The general expression and purification protocol includes:

  • Cloning the kdpC gene (Mext_0235) into an appropriate expression vector

  • Transformation into a compatible E. coli strain

  • Induction of protein expression using appropriate conditions

  • Cell lysis and extraction of the recombinant protein

  • Purification using affinity chromatography when tagged (commonly with an N-terminal His-tag)

  • Verification of purity using SDS-PAGE (typically achieving ≥85% purity)

The recombinant protein is often tagged with a His-tag to facilitate purification while maintaining functional integrity, similar to the approach used for related Methylobacterium nodulans kdpC (1-201aa) .

What expression systems are effective for producing functional kdpC protein?

While E. coli remains the primary expression system for kdpC production, several expression platforms have proven effective for producing functional kdpC protein:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliFast growth, high yield, simple culture conditionsPotential issues with protein folding, lack of post-translational modifications10-50 mg/L culture
YeastPost-translational modifications, proper folding of complex proteinsLonger cultivation time, more complex media requirements5-20 mg/L culture
BaculovirusAdvanced eukaryotic folding machinery, high-level expressionTechnical complexity, longer production time10-40 mg/L culture
Mammalian CellMost sophisticated protein processing, authentic modificationsHighest cost, slowest production, complex media1-10 mg/L culture

Each system has been successfully employed for kdpC expression, with selection depending on downstream application requirements and available laboratory resources .

What are the structural characteristics of the kdpC protein and how do they relate to its function?

The kdpC protein forms part of the membrane-spanning component of the KdpFABC complex, which functions as a P-type ATPase. While specific structural data for Methylobacterium extorquens kdpC is limited, research on homologous proteins reveals important structural features:

  • Transmembrane domains that anchor the protein in the cell membrane

  • Interaction interfaces with other subunits (particularly kdpB, the catalytic subunit)

  • A potassium-binding domain that facilitates ion recognition and translocation

The catalytic mechanism involves ATP binding to create conformational changes that drive potassium transport. The nucleotide-binding site typically contains conserved motifs, including:

  • P-loop motifs with the sequence pattern GX₁X₂X₃X₄GK[T/S]

  • Catalytic residues (commonly including lysine, arginine, and glutamate) that coordinate with the γ-phosphate of ATP

The coordinated action of these structural elements enables the enzyme to couple ATP hydrolysis with potassium transport across the membrane.

How does the P-loop motif in kdpC contribute to ATPase activity?

The P-loop motif in kdpC is critical for its ATPase functionality. Research on P-loop containing ATPases reveals:

The P-loop motif exhibits a cradle-like conformation that encompasses the α- and β-phosphate groups of ATP, with the conserved lysine primarily interacting with the β-phosphate moiety . The optimal orientation of this lysine residue points inward to the P-loop cradle, relative to the plane defined by the Cα atoms, facilitating the interaction with the β-phosphate .

Structural data shows that in the nucleotide-binding site:

  • The γ-phosphate of ATP and magnesium ions are coordinated by lysine and serine residues on the P-loop

  • Aromatic residues often orient away from the triphosphate moiety to allow access of the guanidium group to the arginine finger

  • The adenine moiety is typically occluded in a binding pocket formed by hydrophobic residues

These structural arrangements enable the controlled hydrolysis of ATP that powers potassium transport across bacterial membranes.

What are the optimal conditions for expressing and purifying active recombinant kdpC?

Optimal conditions for expressing and purifying active recombinant kdpC involve careful control of multiple parameters:

ParameterOptimal ConditionRationale
Expression hostBL21(DE3) E. coli strainLacks lon and ompT proteases; contains T7 RNA polymerase
Growth temperature18-25°C post-inductionReduces inclusion body formation; enhances proper folding
Induction OD₆₀₀0.6-0.8Ensures cells are in log phase for optimal expression
IPTG concentration0.1-0.5 mMLower concentrations reduce metabolic burden and improve folding
Post-induction time12-16 hoursExtended time at lower temperature improves yield of soluble protein
Lysis buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSFStabilizes protein during extraction
Purification methodIMAC followed by size exclusion chromatographyTwo-step purification enhances purity to >95%

For functional studies, maintaining the protein in a buffer containing 50 mM Tris-HCl pH 7.5, 100 mM KCl, 5 mM MgCl₂, and 10% glycerol post-purification helps preserve activity.

How can researchers effectively assess the ATPase activity of purified kdpC?

Assessing the ATPase activity of purified kdpC requires specific methodological approaches:

  • Colorimetric Phosphate Release Assay:

    • Reaction mixture: 50 mM Tris-HCl (pH 7.5), 100 mM KCl, 5 mM MgCl₂, 2-5 μg purified protein, 1-5 mM ATP

    • Incubation: 30 minutes at 37°C

    • Detection: Malachite green assay to quantify released inorganic phosphate

    • Controls: Include samples with heat-inactivated enzyme and without ATP

  • Coupled Enzyme Assay:

    • Principle: ATP hydrolysis is coupled to NADH oxidation through pyruvate kinase and lactate dehydrogenase

    • Detection: Continuous monitoring of NADH absorbance decrease at 340 nm

    • Advantage: Real-time kinetics data

  • ATP-Regenerating System:

    • Components: Phosphoenolpyruvate and pyruvate kinase to regenerate ATP

    • Benefit: Maintains constant ATP levels for extended measurements

Data analysis should include calculation of specific activity (μmol Pi released/min/mg protein) and kinetic parameters (Km, Vmax) using appropriate enzyme kinetics software.

How does kdpC function differ between Methylobacterium species and what are the implications for methanol metabolism?

The kdpC function shows important variations between Methylobacterium species that correlate with their adaptation to different environments and methanol utilization capabilities:

Methylobacterium SpecieskdpC Gene IDNotable Functional CharacteristicsMethanol Tolerance
M. extorquensMext_0235Enhanced potassium transport efficiencyHigh (adaptable to 10% v/v)
M. nodulansMnod_0196Stress-responsive regulationModerate
M. radiotoleransVarious strainsRadiation and stress resistanceVariable by strain

Research indicates that potassium transport systems, including the kdpC-containing complex, play critical roles in Methylobacterium species' adaptation to high methanol concentrations. In M. extorquens specifically, potassium homeostasis is implicated in methanol stress responses .

While methanol toxicity in M. extorquens is primarily associated with MetY (O-acetyl-L-homoserine sulfhydrylase) producing toxic methoxine , the kdpC-facilitated potassium transport appears to play a supporting role in maintaining cellular homeostasis under methanol stress conditions. Strains adapted to high methanol concentrations (up to 10% v/v) show altered expression patterns of membrane transport systems , which may include modifications to kdpC function or regulation.

What role does the kdpC protein play in the adaptation of Methylobacterium extorquens to high methanol concentrations?

The kdpC protein plays a complex role in M. extorquens adaptation to high methanol concentrations through several mechanisms:

  • Membrane Integrity Maintenance: As a component of the potassium transport system, kdpC helps maintain membrane potential and integrity under methanol stress conditions that would otherwise compromise membrane fluidity.

  • Osmotic Regulation: High methanol concentrations create osmotic challenges for bacterial cells. The kdpC-containing potassium transport system helps balance osmotic pressure by regulating intracellular potassium levels.

  • Energy Homeostasis: The ATP-dependent nature of the KdpFABC complex (of which kdpC is a component) links potassium transport to cellular energetics, which is particularly important during adaptation to high methanol where energy demands for detoxification and repair increase.

It's noteworthy that during adaptation to high methanol (10% v/v), M. extorquens strains showed unchanged fatty acid membrane composition , suggesting that functional adaptations in membrane proteins like kdpC may be more important than changes to membrane lipid structure.

How can researchers design experiments to investigate the interaction between kdpC and other components of the potassium transport system?

Designing experiments to investigate kdpC interactions with other KdpFABC complex components requires multiple complementary approaches:

  • Co-Immunoprecipitation (Co-IP) Studies:

    • Express kdpC with an epitope tag (e.g., FLAG, HA)

    • Cross-link proteins in vivo if interactions are transient

    • Immunoprecipitate using tag-specific antibodies

    • Identify interacting partners via mass spectrometry

    • Validate findings using reverse Co-IP with antibodies against identified partners

  • Bacterial Two-Hybrid System:

    • Clone kdpC and potential interacting partners into appropriate vectors

    • Transform into reporter bacterial strain

    • Measure reporter gene expression to quantify interaction strength

    • Create deletion constructs to map interaction domains

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified kdpC on sensor chip

    • Flow potential binding partners over the surface

    • Measure real-time binding kinetics (kon, koff, KD)

    • Test different buffer conditions to optimize interactions

  • Site-Directed Mutagenesis:

    • Identify conserved residues potentially involved in protein-protein interactions

    • Create point mutations at these positions

    • Assess impact on complex formation and activity

    • Table of potential mutation sites:

Residue PositionConservationPredicted RoleMutation Strategy
Conserved lysines in P-loopHighATP bindingK→A substitution
Transmembrane interface residuesModerateSubunit interactionAlanine scanning
C-terminal domainVariableRegulatory functionTruncation series

These approaches should be complemented with functional assays measuring potassium transport and ATPase activity to correlate structural interactions with functional outcomes.

How does the structure and function of kdpC in Methylobacterium extorquens compare to homologous proteins in other bacterial species?

The kdpC protein in Methylobacterium extorquens shares structural and functional similarities with homologs in other bacterial species, but with important distinctions:

Bacterial SpecieskdpC CharacteristicsUnique FeaturesFunctional Implications
Methylobacterium extorquensMext_0235 gene product; part of methanol-utilizing metabolismAdapted for function in methylotrophyEnhanced role in C1 metabolism support
Bacillus anthracisComponent of stress response systemAdditional regulatory elementsInvolved in pathogenicity and stress resistance
Escherichia coliWell-characterized model systemExtensively studied regulatory networkPrototype for understanding basic kdpC function
Azorhizobium caulinodansAZC_1567 gene; associated with nitrogen fixationIntegrated with symbiotic systemsRole in plant-microbe interactions
Salmonella speciesVarious strains with pathogenicity-associated featuresVirulence-related adaptationsPotential role in host infection processes

Sequence alignments reveal conserved regions corresponding to the ATP-binding domain and transmembrane segments across these species, with the greatest variations occurring in regulatory regions . The conservation pattern suggests that the core catalytic function remains similar, while regulatory mechanisms have evolved to support species-specific metabolic adaptations.

In Methylobacterium extorquens specifically, the kdpC protein appears optimized to support the unique energetic and osmotic challenges associated with methylotrophic metabolism, particularly the adaptation to growth on methanol as a sole carbon and energy source .

What evolutionary insights can be gained from studying kdpC protein sequences across different Methylobacterium species?

Evolutionary analysis of kdpC sequences across Methylobacterium species reveals important insights into adaptation and specialization:

  • Phylogenetic Patterns:

    • kdpC sequences cluster according to metabolic specialization rather than strict taxonomic relationships

    • Species isolated from similar environments (plant surfaces, soil, aquatic) show convergent adaptations in kdpC sequence

  • Selection Pressure Analysis:

    • Transmembrane domains show higher conservation (purifying selection)

    • ATP-binding regions maintain strict sequence requirements

    • Species-specific variations occur primarily in regulatory domains, suggesting adaptive evolution

  • Correlation with Ecological Niches:

    • Plant-associated Methylobacterium species (e.g., M. extorquens, M. nodulans) show kdpC adaptations that may facilitate symbiotic relationships

    • The high production of phytohormones by Methylobacterium species correlates with specific kdpC characteristics that support osmotic adaptation during plant colonization

  • Horizontal Gene Transfer Assessment:

    • Limited evidence of horizontal kdpC acquisition between Methylobacterium and other genera

    • Most sequence variation appears to result from vertical inheritance with adaptive mutations

This evolutionary perspective provides context for understanding how kdpC function has been optimized for the methylotrophic lifestyle and various ecological niches occupied by different Methylobacterium species.

What are common challenges in working with recombinant kdpC and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant kdpC. The following table outlines common issues and recommended solutions:

ChallengePossible CausesSolutions
Low expression yieldCodon bias, protein toxicityOptimize codon usage, use slower promoters, lower incubation temperature
Protein insolubilityImproper folding, membrane protein characteristicsAdd solubility enhancers (CHAPS, glycerol), use fusion tags (MBP, SUMO)
Loss of activity during purificationDetergent effects, cofactor lossInclude stabilizing agents (potassium, magnesium), optimize detergent type and concentration
Aggregation post-purificationImproper buffer conditions, concentration effectsAdd stabilizers (trehalose, sucrose), maintain dilute conditions
Inconsistent activity measurementsBuffer variability, enzyme instabilityStandardize buffer preparation, include fresh reducing agents, minimize freeze-thaw cycles

Additional methodology refinements:

  • For membrane protein expression, consider specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein production

  • If expression yield remains problematic, cell-free protein synthesis systems may offer alternatives for difficult-to-express membrane proteins

  • For activity assays, include proper controls with known ATPase inhibitors to verify specificity

How can researchers optimize experimental design for studying kdpC function in the context of methanol metabolism?

Optimizing experimental design for studying kdpC function in methanol metabolism requires careful consideration of several factors:

  • Growth Conditions Standardization:

    • Medium composition: Use standard mineral (SM) medium with controlled methanol concentrations

    • Growth parameters from literature: 30°C, constant agitation, starting OD₆₀₀ of 0.01

    • Methanol concentration series: 0.25%, 1%, 5%, and 10% (v/v) to match published adaptation studies

  • Genetic Manipulation Approaches:

    • Gene deletion: Create ΔkdpC knockout strains using established Methylobacterium genetic tools

    • Complementation: Express wild-type and mutant versions of kdpC to assess functional restoration

    • Reporter fusion: Create kdpC-GFP fusions to monitor expression and localization

  • Physiological Measurements:

  • Data Analysis Framework:

    • Establish clear metrics for methanol tolerance (growth rate, final biomass, viability)

    • Use statistical approaches to determine significance of observed differences

    • Create comprehensive data tables following scientific standards:

Methanol Concentration (v/v)Wild-type Growth Rate (h⁻¹)ΔkdpC Growth Rate (h⁻¹)Complemented Strain Growth Rate (h⁻¹)
0.25%[value ± SD][value ± SD][value ± SD]
1%[value ± SD][value ± SD][value ± SD]
5%[value ± SD][value ± SD][value ± SD]
10%[value ± SD][value ± SD][value ± SD]
  • Integration with Transcriptomics:

    • Monitor kdpC expression changes during methanol adaptation

    • Correlate with other differentially expressed genes, particularly those involved in stress response

    • Connect findings with known methanol adaptation mechanisms, such as MetY inactivation

This experimental framework provides a systematic approach to investigating kdpC's role in methanol metabolism while building on established methanol adaptation research in Methylobacterium species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.