Recombinant Methylobacterium nodulans Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Methylobacterium nodulans

Methylobacterium nodulans is a species of bacteria known for its ability to induce nitrogen-fixing root nodules on certain legume species . Methylobacterium species can grow on C1 compounds like methanol, formate, and formaldehyde, but not methylamine, as their sole carbon source . They possess the mxaF gene, which encodes methanol dehydrogenase, supporting their methylotrophic metabolism . Some Methylobacterium strains can secrete phytohormones, including various forms of cytokinins (CKs) and indole-3-acetic acid (IAA) .

Function of LspA

LspA, also known as lipoprotein signal peptidase II, is an aspartyl protease that processes lipoproteins in bacteria . Lipoproteins are synthesized as preproteins with an N-terminal signal peptide that includes a lipobox, a conserved sequence containing a cysteine residue that is modified with diacylglyceryl . LspA cleaves the signal peptide after the modified cysteine, which is essential for the proper localization and function of lipoproteins .

LspA enzymes typically have four transmembrane-spanning regions, and five conserved sequence regions have been identified through comparisons of various Lsp sequences . Research indicates that certain aspartic acid residues within LspA are essential for its activity, suggesting it belongs to the aspartic peptidase family .

LspA as a Target for Antibiotics

Due to its role in bacterial cell envelope integrity, LspA is a target for developing new antibiotics . Antibiotics like globomycin and myxovirescin inhibit LspA by blocking its catalytic dyad, which compromises the bacterial cell envelope .

LspA and Bacterial Pathogenesis

LspA activity is important for bacterial survival in the host . Studies have shown that lspA mutants have a reduced ability to survive in human blood, indicating that LspA contributes to the virulence of bacteria .

LspA in Streptococcus uberis

In Streptococcus uberis, LspA is involved in lipoprotein processing . Mutants lacking LspA display novel lipoprotein processing, with full-length, uncleaved MtuA (a protein essential for virulence) detected .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your preferred tag type during ordering, and we will prioritize its use.
Synonyms
lspA; Mnod_0392; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Target Names
lspA
Target Protein Sequence
MRPLPFGLLVAAATLVLDQATKLGLLFLTDLPIRQPIVLAPFAQLVVVWNRGVSYGLFQQ HTELGRWLLVAVSVLAAVALTAWMARTGTRLLAGALGLIVGGAIGNAIDRIAYGAVFDFV HLHAGGWSWYVFNVADAGIVLGVAGLLYDAVRAERRNAREIRSDA
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of LspA in Methylobacterium nodulans?

LspA (lipoprotein signal peptidase) in M. nodulans, like in other bacteria, is responsible for cleaving the signal peptide sequence of prelipoproteins after lipid modification. This processing is essential for proper lipoprotein maturation and localization in the bacterial cell envelope. Similar to LspA in other bacteria, M. nodulans LspA likely plays a critical role in cell envelope integrity, bacterial physiology, and potentially virulence or environmental adaptation .

The enzyme functions as an aspartyl protease with a catalytic dyad that recognizes lipid-modified cysteine residues in the lipobox of preproteins . Unlike in Gram-negative bacteria where LspA is essential, the importance of LspA in alphaproteobacteria like Methylobacterium may vary depending on environmental conditions and growth strategies .

How can I express recombinant M. nodulans LspA in a laboratory setting?

Recombinant M. nodulans LspA can be expressed using standard protein expression systems with modifications for membrane proteins. Based on successful approaches with other bacterial LspA proteins:

  • Expression system selection: E. coli BL21(DE3) or similar strains are recommended for membrane protein expression.

  • Vector construction: Clone the M. nodulans lspA gene into an expression vector with a hexahistidine tag for purification.

  • Expression conditions:

    • Induce expression at lower temperatures (16-20°C)

    • Use reduced inducer concentrations

    • Consider longer induction times (16-24 hours)

  • Membrane extraction: Use detergent solubilization with mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) .

For optimal results, expression trials comparing different conditions are recommended, as membrane protein expression can be challenging and often requires optimization.

What assays can I use to confirm LspA activity in recombinant preparations?

Two reliable methods to confirm LspA activity are:

  • Gel-shift assay: This approach uses a recombinant prolipoprotein substrate (like proICP) to visualize the processing of the prolipoprotein to its mature form through SDS-PAGE. The cleaved product will migrate faster, creating a detectable band shift .

  • Fluorescence Resonance Energy Transfer (FRET) assay: This more sensitive technique uses a synthetic FRET lipopeptide substrate. The assay can provide quantitative kinetic data including apparent Km and Vmax values .

Table 1: Comparison of LspA Activity Assay Methods

ParameterGel-shift AssayFRET Assay
SensitivityLowerHigher
QuantificationSemi-quantitativeFully quantitative
Equipment neededSDS-PAGE apparatusFluorescence microplate reader
SubstrateRecombinant prolipoproteinSynthetic FRET lipopeptide
Time requiredLonger (hours)Shorter (minutes)
Data outputVisual band shiftKinetic parameters (Km, Vmax)

Both methods can also be used to test inhibitor efficacy by measuring changes in LspA activity in their presence .

How do I determine the kinetic parameters of recombinant M. nodulans LspA?

Determining kinetic parameters requires optimized FRET-based assays. Based on protocols for other LspA enzymes:

  • Substrate preparation: Use synthetic FRET lipopeptides that mimic the native lipoprotein substrates of M. nodulans.

  • Assay optimization:

    • Buffer composition: Test various pH values and ionic strengths

    • Detergent selection: DDM or LMNG at concentrations above CMC

    • Temperature optimization: typically 25-37°C

  • Kinetic measurements:

    • Use substrate concentrations ranging from 0.1-10× the estimated Km

    • Determine initial velocities at each substrate concentration

    • Plot data using Michaelis-Menten, Lineweaver-Burk, or Eadie-Hofstee methods

  • Data analysis: Calculate apparent Km and Vmax values using non-linear regression .

For context, LspA from P. aeruginosa shows an apparent Km of approximately 10 μM and Vmax of 107 nmol/(mg·min) at 0.1 μM enzyme concentration, while S. aureus LspA exhibits approximately 47 μM Km and 2.5 nmol/(mg·min) Vmax at 0.3 μM enzyme concentration . Expect M. nodulans LspA to have its own distinct kinetic profile based on its evolutionary relationship to these enzymes.

What strategies can I employ to obtain crystal structures of M. nodulans LspA?

Obtaining crystal structures of membrane proteins like LspA is challenging but feasible following these methodological steps:

  • Protein purification optimization:

    • Scale up expression

    • Implement multi-step purification (nickel affinity, size exclusion, ion exchange)

    • Achieve >95% purity and stability in solution

    • Consider adding stabilizing lipids/detergents

  • Crystallization screening:

    • Use commercial membrane protein screens

    • Test various detergents and lipid compositions

    • Employ vapor diffusion, lipidic cubic phase, or bicelle methods

    • Consider crystallization with inhibitors like globomycin or myxovirescin for stability

  • Crystal optimization:

    • Fine-tune promising conditions

    • Consider microseeding

    • Test additives and precipitants systematically

  • Data collection and processing:

    • Collect high-resolution X-ray diffraction data

    • Process using standard crystallographic software

    • Consider molecular replacement using existing LspA structures (e.g., from S. aureus or P. aeruginosa) as search models

Recent success with S. aureus LspA structures demonstrates the feasibility of this approach, particularly when co-crystallized with inhibitors that stabilize the protein .

How does environmental adaptation influence LspA expression and function in Methylobacterium nodulans?

Understanding the environmental influence on LspA expression in M. nodulans requires integrating phylogenetic and ecological approaches:

  • Comparative expression analysis:

    • Analyze LspA expression under different growth conditions using RT-qPCR or RNA-seq

    • Compare expression across seasons, host plants, and growth phases

    • Correlate expression with environmental parameters

  • Ecological sampling strategy:

    • Design sampling across biogeographic regions and seasonal variations

    • Include diverse host species to assess host-specific adaptations

    • Apply statistical methods like PERMANOVA to analyze contributions of forest (F), plot within forest (P), host species (H), and time (T) on gene expression

  • Functional characterization across conditions:

    • Measure enzymatic activity under different pH, temperature, and ionic conditions

    • Assess substrate specificity changes in response to environmental shifts

    • Evaluate potential adaptive changes in LspA function

Based on studies of Methylobacterium diversity, expect significant variation in expression patterns that correlate with biogeography, seasonality, and host associations . These variations likely reflect ecological adaptations that influence LspA function in cell envelope maintenance under different environmental conditions.

How can I design effective inhibitors targeting M. nodulans LspA?

Designing effective LspA inhibitors requires a structure-guided approach:

  • Structural analysis:

    • Focus on the active site architecture of M. nodulans LspA

    • Identify catalytic residues and substrate binding pockets

    • Study existing inhibitor complexes as templates

  • Inhibitor design strategy:

    • Target the 19-atom motif identified in both globomycin and myxovirescin that mimics the substrate lipoprotein binding mode

    • Design compounds that block the catalytic dyad as non-cleavable tetrahedral intermediate analogs

    • Consider species-specific variations in the binding pocket

  • Validation experiments:

    • Test inhibitor efficacy using FRET and gel-shift assays

    • Determine IC50 values and inhibition kinetics

    • Verify mode of binding through crystallography or molecular dynamics

Recent structural studies of S. aureus LspA revealed that chemically distinct antibiotics (globomycin and myxovirescin) inhibit the enzyme identically, despite approaching from different sides of the substrate-binding pocket . This convergent inhibition mechanism provides a blueprint for designing new inhibitors with potentially improved pharmacokinetic properties.

What role does sequential experimental design play in optimizing recombinant LspA expression and purification?

Sequential experimental design is crucial for efficiently optimizing LspA expression:

  • Initial screening phase:

    • Employ Plackett-Burman design to screen many factors with minimal experiments

    • Identify significant factors affecting expression yield and activity

    • Focus on key variables like temperature, inducer concentration, and expression time

  • Optimization phase:

    • Apply response surface methodology (RSM) or central composite design

    • Create mathematical models relating significant factors to yield and activity

    • Visualize optimal conditions through contour and surface plots

  • Validation and refinement:

    • Test predicted optimal conditions

    • Implement iterative refinement based on experimental results

    • Apply Monte Carlo simulation to assess robustness of optimal conditions

This approach is more efficient than traditional one-factor-at-a-time methods, as it reveals important interactions between variables while minimizing the number of experiments needed . For membrane proteins like LspA, sequential experimental design is particularly valuable given the complexity and cost of expression and purification processes.

How does the function of LspA in M. nodulans compare to its role in other bacterial species?

Comparing LspA function across bacterial species reveals important evolutionary adaptations:

  • Essentiality comparison:

    • LspA is essential in Gram-negative bacteria but not in most Gram-positive bacteria

    • For M. nodulans, determine essentiality through knockout studies under various conditions

    • Compare growth rates and viability of wild-type vs. lspA mutants

  • Functional redundancy analysis:

    • In some bacteria like S. uberis, other proteases (e.g., Eep) can partially compensate for LspA function

    • Investigate potential redundant systems in M. nodulans through double mutant studies

    • Assess the role of Eep homologues in lipoprotein processing

  • Virulence and adaptation implications:

    • In S. aureus, LspA contributes to survival in human blood but is not essential for growth in vitro

    • For M. nodulans, investigate the role of LspA in symbiotic relationships with plants

    • Compare phenotypes across environmental conditions

Table 2: Comparison of LspA Characteristics Across Bacterial Species

Bacterial SpeciesEssentialityProcessing FeaturesInhibitor Sensitivity
E. coli (Gram-negative)EssentialStandard processingHigh (globomycin)
P. aeruginosaEssentialKm ~10 μM, Vmax ~107 nmol/(mg·min)High (IC50 ~0.64 μM)
S. aureus (Gram-positive)Non-essentialKm ~47 μM, Vmax ~2.5 nmol/(mg·min)Variable (IC50 ~171 μM with proICP)
S. uberisNon-essentialAlternative processing by EepNot reported
M. nodulans (predicted)Likely non-essentialUnknown, requires characterizationUnknown, requires testing

Understanding these differences provides insight into the evolutionary adaptations of lipoprotein processing systems across bacterial phyla and ecological niches .

What are common pitfalls in expressing and purifying active recombinant LspA?

Researchers frequently encounter several challenges when working with LspA:

  • Low expression yields:

    • Problem: Membrane protein overexpression can be toxic to host cells

    • Solution: Use tunable expression systems, lower induction temperatures, and specialized E. coli strains designed for membrane proteins

  • Protein aggregation:

    • Problem: Improper folding leading to inclusion bodies

    • Solution: Optimize detergent selection, consider fusion partners, and implement step-wise refolding protocols if needed

  • Low enzymatic activity:

    • Problem: Loss of activity during purification

    • Solution: Minimize time between steps, maintain consistent temperature, add stabilizing lipids, and include protease inhibitors

  • Detergent interference with assays:

    • Problem: Some detergents can interfere with activity assays

    • Solution: Test multiple detergent types/concentrations and validate with multiple assay methods

  • Substrate limitations:

    • Problem: Natural substrates may be unavailable or difficult to prepare

    • Solution: Design synthetic substrate analogs based on predicted M. nodulans lipoprotein sequences

Implementing quality control checks throughout the purification process, including size exclusion chromatography to verify monodispersity, will help ensure consistently active protein preparations.

How can I accurately analyze LspA inhibition data and address apparent contradictions?

When analyzing inhibition data for LspA:

  • Recognize tight-binding inhibitor characteristics:

    • When IC50 values approach enzyme concentration, traditional Michaelis-Menten kinetics may not apply

    • Use Morrison equation for tight-binding inhibitors rather than standard IC50 calculations

  • Address substrate-dependent variations:

    • Different substrates may yield significantly different inhibition profiles

    • For example, S. aureus LspA shows vastly different globomycin sensitivity depending on the substrate (FRET peptide vs. proICP)

    • Test multiple substrate types to get a complete inhibition profile

  • Statistical analysis approaches:

    • Apply appropriate regression models for inhibition data

    • Consider using factorial designs to identify interaction effects between inhibitors, substrates, and conditions

    • Validate findings across multiple experimental replicates

  • Reconciling contradictory results:

    • Compare experimental conditions systematically when results differ

    • Consider enzyme concentration effects, buffer composition, and substrate identity

    • Look for species-specific variations that might explain differences

These methodological considerations are essential for accurate characterization of LspA inhibitors and can help resolve apparent contradictions in experimental results.

How can I use molecular dynamics simulations to understand M. nodulans LspA function?

Molecular dynamics (MD) simulations provide valuable insights into LspA function:

  • System preparation:

    • Build M. nodulans LspA homology model based on available crystal structures

    • Embed protein in a lipid bilayer that mimics bacterial membrane composition

    • Add water molecules and counterions to neutralize the system

  • Simulation protocol:

    • Perform energy minimization and system equilibration

    • Run production simulations for >100 ns to capture relevant dynamics

    • Consider enhanced sampling techniques for substrate binding events

  • Analysis approaches:

    • Track active site conformational changes

    • Analyze water and ion movement through the protein

    • Characterize substrate binding pathways and energetics

    • Identify allosteric sites and communication networks

  • Application to inhibitor design:

    • Simulate inhibitor binding and stability

    • Calculate binding free energies using methods like MM-PBSA

    • Identify key interaction residues for structure-activity relationships

These simulations can reveal dynamic aspects of LspA function not captured in static crystal structures and provide atomistic insight into species-specific variations in substrate recognition and inhibitor binding.

What statistical approaches are most appropriate for analyzing LspA mutational studies?

When conducting comprehensive mutational studies of LspA:

  • Experimental design considerations:

    • Use factorial designs to efficiently test multiple mutations

    • Include controls (wild-type and catalytically inactive variants)

    • Consider epistatic effects through double mutant analyses

  • Statistical analysis methods:

    • Analysis of variance (ANOVA) for comparing multiple mutants

    • Multiple regression to model relationships between mutations and activity

    • Principal component analysis to identify patterns in multidimensional data

    • Hierarchical clustering to group functionally similar mutants

  • Structure-function correlation:

    • Map statistical findings onto structural models

    • Identify functionally important residue networks

    • Apply molecular dynamics to rationalize unexpected mutational effects

  • Evolutionary analysis integration:

    • Compare mutational effects to sequence conservation patterns

    • Identify co-evolving residues through statistical coupling analysis

    • Relate findings to environmental adaptation patterns in Methylobacterium

These approaches provide rigorous frameworks for interpreting complex mutational data and connecting sequence variations to functional differences in LspA across bacterial species.

How might systems biology approaches enhance our understanding of LspA in bacterial lipid metabolism?

Systems biology offers powerful frameworks for understanding LspA's role in broader metabolic contexts:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and lipidomics data

    • Map lipid metabolism changes in lspA mutants

    • Identify compensatory pathways activated in response to LspA disruption

  • Network analysis approaches:

    • Construct protein-protein interaction networks centered on LspA

    • Identify genetic interactions through synthetic lethality screens

    • Map metabolic flux changes in response to LspA inhibition

  • Mathematical modeling:

    • Develop ordinary differential equation models of lipoprotein processing

    • Integrate models with whole-cell simulations

    • Predict system-level responses to perturbations

  • Experimental validation strategies:

    • Use CRISPR interference for targeted gene modulation

    • Apply metabolic flux analysis to validate model predictions

    • Implement sequential experimental design for efficient hypothesis testing

These approaches will provide a comprehensive understanding of how LspA functions within the broader context of bacterial physiology and environmental adaptation.

What are the most promising approaches for studying LspA in situ within native Methylobacterium nodulans cells?

Studying LspA in its native cellular context requires advanced imaging and molecular techniques:

  • Super-resolution microscopy approaches:

    • Apply techniques like STORM or PALM for nanoscale visualization

    • Use fluorescent protein fusions or small molecule tags for labeling

    • Track LspA localization and dynamics under different conditions

  • Cryo-electron tomography:

    • Visualize LspA in the native membrane environment

    • Observe structural arrangements and protein complexes

    • Compare wild-type cells to mutants or inhibitor-treated samples

  • In vivo activity probes:

    • Develop chemical biology tools to monitor LspA activity directly in cells

    • Design fluorescent or bioluminescent reporters linked to lipoprotein processing

    • Measure activity changes in response to environmental stimuli

  • Native membrane proteomics:

    • Apply proximity labeling techniques to identify LspA interaction partners

    • Use quantitative proteomics to measure global effects of LspA inhibition

    • Implement pulse-chase methods to track lipoprotein maturation kinetics

These approaches will bridge the gap between in vitro biochemical characterization and physiological function, providing insight into how M. nodulans LspA contributes to bacterial adaptation in diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.