Recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K (nuoK) is a bacterial protein expressed in Escherichia coli for research and diagnostic applications. It is a component of NADH dehydrogenase I (Complex I), a key enzyme in aerobic respiration that couples NADH oxidation to proton translocation and quinone reduction . The protein is critical for understanding bacterial energy metabolism and its role in oxidative phosphorylation pathways .
The full-length protein sequence (1–101 amino acids) is:
MIGLSHYLTVAAILFTLGVLGIFINRKNIIVILMSVELILLAVNINLVAFSAYLGDIVGQ VFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNMMKG .
This structure includes conserved motifs required for interaction with other Complex I subunits and electron transfer intermediates (e.g., ubiquinone) .
nuoK is part of the NADH:quinone oxidoreductase (Complex I), which operates in:
Oxidative Phosphorylation: Transfers electrons from NADH to ubiquinone while pumping protons across membranes .
Electron Transport Chain: Critical in Methylobacterium nodulans for energy generation during methylotrophy (one-carbon metabolism) .
| Pathway | Module | Function |
|---|---|---|
| ko00190 (Oxidative phosphorylation) | M00144 (NADH:quinone oxidoreductase, prokaryotes) | Electron transfer and proton translocation |
Expression System: Recombinant nuoK is produced in E. coli under optimized conditions for solubility and yield .
Purification: Affinity chromatography (via His-tag) followed by SDS-PAGE validation .
Post-Translational Modifications: Not explicitly reported, but potential phosphorylation or ubiquitination may occur in native contexts .
ELISA Development: Used as an antigen in immunoassays for detecting anti-nuoK antibodies .
Structural Studies: Probed for interactions with quinones or Fe-S clusters in Complex I .
Methylotrophy Research: Studied in Methylobacterium nodulans to understand its dual role in nitrogen fixation and one-carbon metabolism .
Proton Translocation: nuoK contributes to proton pumping via conformational changes during NADH oxidation .
Methylotrophy: Methylobacterium nodulans utilizes nuoK in energy production while fixing nitrogen in Crotalaria legumes .
Complex I Assembly: Interacts with subunits A, B, and C to form the hydrophilic domain of Complex I .
KEGG: mno:Mnod_4136
STRING: 460265.Mnod_4136
Methylobacterium nodulans NADH-quinone oxidoreductase subunit K (nuoK) is a relatively small protein component of the larger NADH-quinone oxidoreductase complex (Complex I) in the bacterial respiratory chain. According to recombinant protein specifications, the full-length protein consists of 101 amino acids . The protein typically contains hydrophobic regions that anchor it to the membrane, facilitating electron transport across the bacterial membrane. When expressed recombinantly, the protein is often tagged, commonly with an N-terminal histidine tag, to facilitate purification and detection in laboratory settings. This structural composition is critical to understand as it influences protein folding, stability, and functional properties in experimental contexts.
The amino acid sequence determines the protein's three-dimensional structure, which in turn affects its interaction with other subunits in the NADH-quinone oxidoreductase complex. Understanding this basic composition provides the foundation for more advanced research questions regarding protein function and interactions within the metabolic pathways of Methylobacterium nodulans.
The expression system significantly impacts both the yield and quality of recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K. Based on available data, E. coli is commonly used as an expression host for this protein . When considering expression systems, researchers should evaluate several factors that affect protein production:
| Expression System | Advantages | Limitations | Optimal Conditions |
|---|---|---|---|
| E. coli | High yield, rapid growth, cost-effective | May lack post-translational modifications | Temperature: 16-25°C, Induction: 0.1-1.0 mM IPTG |
| Yeast systems | Better for membrane proteins, some post-translational modifications | Longer growth time, more complex media | Temperature: 25-30°C, Methanol induction for P. pastoris |
| Insect/Baculovirus | Complex eukaryotic modifications | Higher cost, technical complexity | Temperature: 27°C, pH 6.2-6.4 |
Purification of recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K presents specific challenges due to its membrane-associated nature. An effective purification protocol typically combines multiple techniques tailored to the protein's properties and the presence of affinity tags:
Cell Lysis and Membrane Fraction Isolation: Gentle lysis using either sonication or detergent-based methods, followed by differential centrifugation to isolate the membrane fraction containing nuoK.
Solubilization: Carefully selected detergents (commonly n-dodecyl β-D-maltoside or digitonin at 0.5-2% concentration) to extract the protein from the membrane while maintaining its native conformation.
Affinity Chromatography: For His-tagged nuoK proteins , immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is highly effective. A typical protocol employs a binding buffer containing 20-50 mM imidazole to reduce non-specific binding, followed by elution with 250-500 mM imidazole.
Size Exclusion Chromatography (SEC): As a polishing step to separate the target protein from aggregates and contaminants.
The effectiveness of each purification step should be monitored by SDS-PAGE and Western blot analysis. For functional studies, it's crucial to verify that the purified protein retains its activity, which can be assessed through complex I activity assays measuring NADH oxidation rates.
Researchers should optimize detergent concentration and buffer conditions to maximize protein stability during purification, as membrane proteins are particularly susceptible to denaturation and aggregation during the extraction and purification process.
When designing data tables for nuoK activity measurements, researchers should follow principles that ensure clear organization and presentation of independent and dependent variables. Based on established scientific experimental design guidelines4, the following structure is recommended:
| Independent Variable (e.g., Substrate Concentration) | Dependent Variable (Activity Measurements) | Statistical Parameters |
|---|---|---|
| Clear units and incremental values | Raw data for each trial | Standard deviation |
| Control condition | Average of replicate measurements | Standard error |
| Experimental conditions | Calculated specific activity | p-values for statistical significance |
For experiments measuring NADH-quinone oxidoreductase activity of nuoK:
Independent variables should be placed in the leftmost column and might include factors you are actively controlling such as substrate concentration, pH, temperature, or inhibitor concentration4.
Dependent variables are the measurements resulting from your experimental conditions, such as enzyme activity rate, electron transfer rate, or protein stability measurements.
Each condition should be tested with at least three replicates to allow for statistical analysis.
Include detailed information in table footnotes about specific experimental conditions that remain constant throughout the experiment (buffer composition, temperature unless it's a variable, etc.).
When researchers encounter data that contradicts expected results or established findings in nuoK functional studies, a systematic approach to resolving these discrepancies is essential. Based on established research practices , the following methodology is recommended:
Thorough Data Examination: First, carefully reexamine all raw data and identify specific points of contradiction. For nuoK studies, contradictions might appear in activity measurements, protein-protein interaction studies, or phenotypic analyses of mutant strains .
Evaluation of Experimental Design:
Technical Validation:
Verify protein quality through multiple methods (e.g., SDS-PAGE, circular dichroism, mass spectrometry)
Confirm assay specificity and sensitivity
Rule out contamination or degradation of the recombinant protein
Alternative Hypotheses Generation: Consider whether the contradictory data might actually reveal new insights about nuoK function or regulation. For instance, unexpected activity patterns might indicate previously unknown regulatory mechanisms or substrate preferences.
Refinement and Additional Controls: Based on identified potential issues, implement additional control experiments that specifically address possible sources of contradiction:
| Type of Contradiction | Possible Causes | Validation Approach |
|---|---|---|
| Unexpected activity levels | Buffer conditions, detergent interference | Systematic variation of conditions with appropriate controls |
| Divergent interaction partners | Tag interference, non-specific binding | Tag-free protein comparison, crosslinking studies with controls |
| Inconsistent phenotypic effects | Background strain variations, secondary mutations | Complementation studies, whole genome sequencing verification |
Remember that contradictory data often leads to the most significant scientific advances, as it challenges existing paradigms and can reveal new aspects of protein function and regulation .
Descriptive Statistics: For all enzyme kinetic data, calculate:
Mean, median, and standard deviation of activity measurements
Coefficient of variation to assess assay precision
95% confidence intervals for activity estimates
Enzyme Kinetics Analysis:
For substrate concentration versus activity data, non-linear regression to determine Km and Vmax values
Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for visualization and alternative parameter estimation
Statistical comparison of kinetic parameters across different experimental conditions
Comparative Analysis:
For comparing nuoK activity under different conditions: One-way ANOVA with appropriate post-hoc tests (Tukey's or Dunnett's)
For comparing wild-type versus mutant forms: Paired t-tests or non-parametric alternatives (Wilcoxon signed-rank test)
For interaction studies: Two-way ANOVA to assess main effects and interactions
Power Analysis:
Determine minimum sample size needed for detecting meaningful differences in nuoK activity
Calculate effect sizes to interpret biological significance beyond statistical significance
| Experimental Question | Recommended Statistical Test | Sample Size Recommendation | Data Transformation |
|---|---|---|---|
| Single mutant vs wild-type | Paired t-test or Wilcoxon | Minimum n=3, preferred n≥5 | Log transformation for non-normal data |
| Multiple conditions | One-way ANOVA with Tukey's post-hoc | Minimum n=4 per group | Consider Box-Cox transformation |
| Multiple factors | Two-way ANOVA | Minimum n=3 per condition | Assess residuals for normality |
| Enzyme kinetics | Non-linear regression | Minimum 7-8 substrate concentrations | Usually none needed |
When reporting results, always include both the test statistic and p-value, and interpret findings in the context of biological significance rather than solely relying on statistical significance thresholds.
Designing effective mutagenesis studies to investigate functional domains of Methylobacterium nodulans NADH-quinone oxidoreductase subunit K requires a systematic approach that integrates structural prediction, conservation analysis, and functional validation:
Sequence Analysis and Target Selection:
Perform multiple sequence alignment of nuoK across bacterial species to identify conserved residues
Use hydropathy analysis to predict transmembrane regions
Apply protein structure prediction algorithms to identify potential functional motifs
Select residues for mutation based on conservation, predicted structural importance, and chemical properties
Mutagenesis Strategy Design:
Alanine scanning mutagenesis: Systematically replace selected residues with alanine to eliminate side chain functionality while maintaining backbone structure
Conservative substitutions: Replace residues with chemically similar amino acids to assess the importance of specific functional groups
Non-conservative substitutions: Introduce dramatic changes to test hypotheses about charge, hydrophobicity, or size requirements
Expression System Optimization:
Functional Characterization Workflow:
| Analysis Level | Techniques | Parameters to Measure | Control Comparisons |
|---|---|---|---|
| Expression/Solubility | Western blot, SDS-PAGE | Protein yield, solubility ratio | Wild-type nuoK, empty vector |
| Membrane Integration | Membrane fractionation, protease accessibility | Localization pattern, topology | Wild-type nuoK, known membrane protein |
| Complex Assembly | Blue native PAGE, co-immunoprecipitation | Complex formation, interaction pattern | Wild-type nuoK, partial complex |
| Enzyme Activity | NADH oxidation assays, electron transfer measurements | Activity rates, substrate affinity | Wild-type nuoK, inactive mutant |
Structure-Function Correlation:
Map functional effects of mutations onto structural models
Identify clusters of functionally important residues that might constitute binding sites or catalytic regions
Develop testable hypotheses about mechanism based on mutational patterns
This comprehensive approach allows researchers to systematically dissect the functional architecture of nuoK, identifying key residues involved in catalysis, substrate binding, protein-protein interactions, and membrane integration.
Studying the interactions between Methylobacterium nodulans NADH-quinone oxidoreductase subunit K and other components of the complex requires specialized techniques that can capture transient and stable protein-protein interactions within a membrane environment. A multi-faceted approach yields the most comprehensive understanding:
In vitro Reconstitution Studies:
Co-purification of interacting subunits using tandem affinity tags
Reconstitution of partial complexes in liposomes or nanodiscs
Activity measurements of reconstituted subcomplexes to assess functional interdependence
Crosslinking Approaches:
Chemical crosslinking with diverse spacer lengths to capture interactions at different distances
Photo-crosslinking with unnatural amino acids incorporated at specific positions in nuoK
Mass spectrometry analysis of crosslinked products to identify interacting regions
Biophysical Interaction Analysis:
Surface plasmon resonance (SPR) with immobilized nuoK to measure binding kinetics
Microscale thermophoresis to detect interactions in solution
Fluorescence resonance energy transfer (FRET) between labeled subunits to measure proximity
Computational Prediction and Validation:
Molecular docking simulations to predict interaction interfaces
Molecular dynamics simulations to assess stability of predicted complexes
Validation of computational predictions through targeted mutagenesis
| Method | Advantages | Limitations | Key Controls |
|---|---|---|---|
| Co-immunoprecipitation | Detects native complexes | Detergent may disrupt interactions | IgG control, reverse IP |
| Chemical crosslinking | Captures transient interactions | May introduce artifacts | No-crosslinker control |
| FRET analysis | Real-time monitoring in membrane | Requires fluorescent labeling | Donor-only, acceptor-only controls |
| Complementation assays | Functional validation of interaction | Indirect evidence | Positive and negative interaction controls |
Genetic Approaches:
Bacterial two-hybrid systems adapted for membrane proteins
Suppressor mutation analysis to identify compensatory changes
Complementation studies with chimeric subunits to map functional interaction domains
By integrating data from multiple complementary approaches, researchers can build a comprehensive model of how nuoK interacts with other components of the NADH-quinone oxidoreductase complex, providing insights into assembly, regulation, and electron transfer mechanisms.
Obtaining functional recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K presents several challenges due to its membrane protein nature. Researchers commonly encounter the following issues, each requiring specific mitigation strategies:
Low Expression Levels:
Challenge: Membrane proteins often express poorly in heterologous systems.
Solution: Optimize codon usage for the expression host, use specialized strains (e.g., C41/C43 for E. coli), and test different promoter strengths. Consider fusion partners like MBP that can enhance solubility and expression.
Protein Misfolding and Aggregation:
Challenge: nuoK may form inclusion bodies or aggregate during expression.
Solution: Lower induction temperature (16-20°C), reduce inducer concentration, and express in the presence of osmolytes or chaperone co-expression systems. For His-tagged constructs , ensure the tag doesn't interfere with proper folding.
Insufficient Membrane Integration:
Challenge: Recombinant nuoK may fail to properly insert into membranes.
Solution: Use specialized membrane targeting sequences, optimize signal peptide design if necessary, and consider in vitro translation systems with supplied membranes or nanodiscs.
Detergent-Mediated Denaturation:
Challenge: Harsh detergents may extract the protein but cause loss of structure/function.
Solution: Screen multiple detergent types and concentrations (systematic approach):
| Detergent Class | Examples | Typical Concentration Range | Best For |
|---|---|---|---|
| Mild non-ionic | DDM, OG, Digitonin | 0.5-2% for extraction, 0.05-0.1% for purification | Maintaining native structure |
| Zwitterionic | CHAPS, LDAO | 0.5-1.5% | Efficient extraction with moderate denaturation |
| Styrene maleic acid copolymers | SMA, diisobutylene maleic acid | 2.5% w/v | Extracting native lipid environment |
Loss of Essential Cofactors or Lipids:
Challenge: Function may depend on specific lipids or cofactors lost during purification.
Solution: Supplement purification buffers with lipid mixtures, perform purification in the presence of stabilizing ligands, and consider native membrane extraction approaches.
Activity Assay Limitations:
Challenge: Difficulty distinguishing nuoK-specific activity from background.
Solution: Develop assays using purified subcomplexes, create activity-null mutants as negative controls, and measure multiple parameters (electron transfer, proton pumping) for comprehensive functional assessment.
Systematic optimization of each step from construct design through expression, purification, and functional reconstitution is essential for obtaining functional recombinant nuoK protein suitable for detailed biochemical and structural studies.
The presence of a histidine tag on recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K can significantly impact both protein function and experimental results. Understanding these effects is crucial for experimental design and data interpretation:
Structural Considerations:
The addition of the His-tag (typically 6-10 histidine residues) modifies the N-terminal region of nuoK, potentially affecting local structure
For membrane proteins like nuoK, N-terminal tags may interfere with membrane insertion or topology
The tag introduces charged residues, which can create artificial electrostatic interactions
Functional Implications:
Electron Transfer Activity: His-tags near functional domains may impede electron flow through the respiratory complex
Complex Assembly: Modified termini might affect interactions with adjacent subunits, altering complex formation efficiency
Substrate/Inhibitor Binding: The tag can create steric hindrance or artificial binding sites
Experimental Considerations and Mitigation Strategies:
| Experimental Aspect | Potential Impact | Mitigation Strategy | Validation Approach |
|---|---|---|---|
| Purification yield | Improved through affinity chromatography | Optimize elution conditions | Compare yields with different purification approaches |
| Activity measurements | May reduce or alter activity | Include tag removal step via protease cleavage site | Compare activity before and after tag removal |
| Structural studies | Can introduce flexibility or aggregation | Move tag position (N vs C-terminal) | Test multiple constructs with different tag positions |
| Binding studies | Can create artificial interactions | Use tag-free protein for final validation | Control experiments with scrambled His sequence |
Empirical Assessment Protocol:
Generate both tagged and untagged versions of nuoK when possible
Compare activity profiles across different substrate concentrations
Assess complex formation efficiency with and without the tag
Perform limited proteolysis to determine if the tag affects protein conformation
Reporting Standards:
Explicitly state tag presence, position, and composition in all methods sections
Discuss potential tag effects in data interpretation
Include tag sequence in protein sequence information
Consider tag effects when comparing results to literature values