Recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant nuoK

Recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K (nuoK) is a bacterial protein expressed in Escherichia coli for research and diagnostic applications. It is a component of NADH dehydrogenase I (Complex I), a key enzyme in aerobic respiration that couples NADH oxidation to proton translocation and quinone reduction . The protein is critical for understanding bacterial energy metabolism and its role in oxidative phosphorylation pathways .

Key Properties

PropertyValue/Description
Gene NamenuoK
UniProt IDB8IUV6
Source OrganismMethylobacterium nodulans (strain ORS2060/LMG 21967)
HostE. coli
TagN-terminal His-tag
LengthFull-length (1–101 amino acids) or partial, depending on product
Molecular Weight~10,780 Da
Purity>85%–90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

Amino Acid Sequence and Domains

The full-length protein sequence (1–101 amino acids) is:
MIGLSHYLTVAAILFTLGVLGIFINRKNIIVILMSVELILLAVNINLVAFSAYLGDIVGQ VFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNMMKG .
This structure includes conserved motifs required for interaction with other Complex I subunits and electron transfer intermediates (e.g., ubiquinone) .

Role in Biochemical Pathways

nuoK is part of the NADH:quinone oxidoreductase (Complex I), which operates in:

  • Oxidative Phosphorylation: Transfers electrons from NADH to ubiquinone while pumping protons across membranes .

  • Electron Transport Chain: Critical in Methylobacterium nodulans for energy generation during methylotrophy (one-carbon metabolism) .

KEGG Pathway Involvement

PathwayModuleFunction
ko00190 (Oxidative phosphorylation)M00144 (NADH:quinone oxidoreductase, prokaryotes)Electron transfer and proton translocation

Expression and Purification

  • Expression System: Recombinant nuoK is produced in E. coli under optimized conditions for solubility and yield .

  • Purification: Affinity chromatography (via His-tag) followed by SDS-PAGE validation .

  • Post-Translational Modifications: Not explicitly reported, but potential phosphorylation or ubiquitination may occur in native contexts .

Stability and Handling

ParameterRecommendation
Storage-20°C/-80°C (long-term), 4°C (short-term working aliquots)
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol (final concentration)
Freeze-Thaw CyclesAvoid repeated cycles to prevent aggregation or degradation
  • ELISA Development: Used as an antigen in immunoassays for detecting anti-nuoK antibodies .

  • Structural Studies: Probed for interactions with quinones or Fe-S clusters in Complex I .

  • Methylotrophy Research: Studied in Methylobacterium nodulans to understand its dual role in nitrogen fixation and one-carbon metabolism .

Key Research Findings

  1. Proton Translocation: nuoK contributes to proton pumping via conformational changes during NADH oxidation .

  2. Methylotrophy: Methylobacterium nodulans utilizes nuoK in energy production while fixing nitrogen in Crotalaria legumes .

  3. Complex I Assembly: Interacts with subunits A, B, and C to form the hydrophilic domain of Complex I .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for prioritized development.
Synonyms
nuoK; Mnod_4136; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Target Names
nuoK
Target Protein Sequence
MIGLSHYLTVAAILFTLGVLGIFINRKNIIVILMSVELILLAVNINLVAFSAYLGDIVGQ VFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNMMKG
Uniprot No.

Target Background

Function
NDH-1 (NADH-quinone oxidoreductase subunit K) facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, the primary electron acceptor is believed to be ubiquinone. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Methylobacterium nodulans NADH-quinone oxidoreductase subunit K?

Methylobacterium nodulans NADH-quinone oxidoreductase subunit K (nuoK) is a relatively small protein component of the larger NADH-quinone oxidoreductase complex (Complex I) in the bacterial respiratory chain. According to recombinant protein specifications, the full-length protein consists of 101 amino acids . The protein typically contains hydrophobic regions that anchor it to the membrane, facilitating electron transport across the bacterial membrane. When expressed recombinantly, the protein is often tagged, commonly with an N-terminal histidine tag, to facilitate purification and detection in laboratory settings. This structural composition is critical to understand as it influences protein folding, stability, and functional properties in experimental contexts.

The amino acid sequence determines the protein's three-dimensional structure, which in turn affects its interaction with other subunits in the NADH-quinone oxidoreductase complex. Understanding this basic composition provides the foundation for more advanced research questions regarding protein function and interactions within the metabolic pathways of Methylobacterium nodulans.

How does the expression system affect recombinant nuoK protein yield and quality?

The expression system significantly impacts both the yield and quality of recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K. Based on available data, E. coli is commonly used as an expression host for this protein . When considering expression systems, researchers should evaluate several factors that affect protein production:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, rapid growth, cost-effectiveMay lack post-translational modificationsTemperature: 16-25°C, Induction: 0.1-1.0 mM IPTG
Yeast systemsBetter for membrane proteins, some post-translational modificationsLonger growth time, more complex mediaTemperature: 25-30°C, Methanol induction for P. pastoris
Insect/BaculovirusComplex eukaryotic modificationsHigher cost, technical complexityTemperature: 27°C, pH 6.2-6.4

What are the most effective purification protocols for recombinant nuoK protein?

Purification of recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K presents specific challenges due to its membrane-associated nature. An effective purification protocol typically combines multiple techniques tailored to the protein's properties and the presence of affinity tags:

  • Cell Lysis and Membrane Fraction Isolation: Gentle lysis using either sonication or detergent-based methods, followed by differential centrifugation to isolate the membrane fraction containing nuoK.

  • Solubilization: Carefully selected detergents (commonly n-dodecyl β-D-maltoside or digitonin at 0.5-2% concentration) to extract the protein from the membrane while maintaining its native conformation.

  • Affinity Chromatography: For His-tagged nuoK proteins , immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is highly effective. A typical protocol employs a binding buffer containing 20-50 mM imidazole to reduce non-specific binding, followed by elution with 250-500 mM imidazole.

  • Size Exclusion Chromatography (SEC): As a polishing step to separate the target protein from aggregates and contaminants.

The effectiveness of each purification step should be monitored by SDS-PAGE and Western blot analysis. For functional studies, it's crucial to verify that the purified protein retains its activity, which can be assessed through complex I activity assays measuring NADH oxidation rates.

Researchers should optimize detergent concentration and buffer conditions to maximize protein stability during purification, as membrane proteins are particularly susceptible to denaturation and aggregation during the extraction and purification process.

How should data tables be designed for experiments involving nuoK activity measurements?

When designing data tables for nuoK activity measurements, researchers should follow principles that ensure clear organization and presentation of independent and dependent variables. Based on established scientific experimental design guidelines4, the following structure is recommended:

Table 1: Recommended Data Table Structure for nuoK Activity Measurements

Independent Variable (e.g., Substrate Concentration)Dependent Variable (Activity Measurements)Statistical Parameters
Clear units and incremental valuesRaw data for each trialStandard deviation
Control conditionAverage of replicate measurementsStandard error
Experimental conditionsCalculated specific activityp-values for statistical significance

For experiments measuring NADH-quinone oxidoreductase activity of nuoK:

  • Independent variables should be placed in the leftmost column and might include factors you are actively controlling such as substrate concentration, pH, temperature, or inhibitor concentration4.

  • Dependent variables are the measurements resulting from your experimental conditions, such as enzyme activity rate, electron transfer rate, or protein stability measurements.

  • Each condition should be tested with at least three replicates to allow for statistical analysis.

  • Include detailed information in table footnotes about specific experimental conditions that remain constant throughout the experiment (buffer composition, temperature unless it's a variable, etc.).

How should researchers address contradictory data in nuoK functional studies?

When researchers encounter data that contradicts expected results or established findings in nuoK functional studies, a systematic approach to resolving these discrepancies is essential. Based on established research practices , the following methodology is recommended:

  • Thorough Data Examination: First, carefully reexamine all raw data and identify specific points of contradiction. For nuoK studies, contradictions might appear in activity measurements, protein-protein interaction studies, or phenotypic analyses of mutant strains .

  • Evaluation of Experimental Design:

    • Assess whether appropriate controls were included

    • Review the selection and preparation of recombinant protein (expression system, purification method)

    • Examine whether the His-tag on the recombinant nuoK might interfere with the function being measured

  • Technical Validation:

    • Verify protein quality through multiple methods (e.g., SDS-PAGE, circular dichroism, mass spectrometry)

    • Confirm assay specificity and sensitivity

    • Rule out contamination or degradation of the recombinant protein

  • Alternative Hypotheses Generation: Consider whether the contradictory data might actually reveal new insights about nuoK function or regulation. For instance, unexpected activity patterns might indicate previously unknown regulatory mechanisms or substrate preferences.

  • Refinement and Additional Controls: Based on identified potential issues, implement additional control experiments that specifically address possible sources of contradiction:

Table 2: Addressing Common Contradictions in nuoK Studies

Type of ContradictionPossible CausesValidation Approach
Unexpected activity levelsBuffer conditions, detergent interferenceSystematic variation of conditions with appropriate controls
Divergent interaction partnersTag interference, non-specific bindingTag-free protein comparison, crosslinking studies with controls
Inconsistent phenotypic effectsBackground strain variations, secondary mutationsComplementation studies, whole genome sequencing verification

Remember that contradictory data often leads to the most significant scientific advances, as it challenges existing paradigms and can reveal new aspects of protein function and regulation .

What statistical approaches are most appropriate for analyzing nuoK enzymatic activity data?

  • Descriptive Statistics: For all enzyme kinetic data, calculate:

    • Mean, median, and standard deviation of activity measurements

    • Coefficient of variation to assess assay precision

    • 95% confidence intervals for activity estimates

  • Enzyme Kinetics Analysis:

    • For substrate concentration versus activity data, non-linear regression to determine Km and Vmax values

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for visualization and alternative parameter estimation

    • Statistical comparison of kinetic parameters across different experimental conditions

  • Comparative Analysis:

    • For comparing nuoK activity under different conditions: One-way ANOVA with appropriate post-hoc tests (Tukey's or Dunnett's)

    • For comparing wild-type versus mutant forms: Paired t-tests or non-parametric alternatives (Wilcoxon signed-rank test)

    • For interaction studies: Two-way ANOVA to assess main effects and interactions

  • Power Analysis:

    • Determine minimum sample size needed for detecting meaningful differences in nuoK activity

    • Calculate effect sizes to interpret biological significance beyond statistical significance

Table 3: Statistical Test Selection Based on Experimental Design

Experimental QuestionRecommended Statistical TestSample Size RecommendationData Transformation
Single mutant vs wild-typePaired t-test or WilcoxonMinimum n=3, preferred n≥5Log transformation for non-normal data
Multiple conditionsOne-way ANOVA with Tukey's post-hocMinimum n=4 per groupConsider Box-Cox transformation
Multiple factorsTwo-way ANOVAMinimum n=3 per conditionAssess residuals for normality
Enzyme kineticsNon-linear regressionMinimum 7-8 substrate concentrationsUsually none needed

When reporting results, always include both the test statistic and p-value, and interpret findings in the context of biological significance rather than solely relying on statistical significance thresholds.

How can researchers design mutagenesis studies to investigate the functional domains of nuoK?

Designing effective mutagenesis studies to investigate functional domains of Methylobacterium nodulans NADH-quinone oxidoreductase subunit K requires a systematic approach that integrates structural prediction, conservation analysis, and functional validation:

  • Sequence Analysis and Target Selection:

    • Perform multiple sequence alignment of nuoK across bacterial species to identify conserved residues

    • Use hydropathy analysis to predict transmembrane regions

    • Apply protein structure prediction algorithms to identify potential functional motifs

    • Select residues for mutation based on conservation, predicted structural importance, and chemical properties

  • Mutagenesis Strategy Design:

    • Alanine scanning mutagenesis: Systematically replace selected residues with alanine to eliminate side chain functionality while maintaining backbone structure

    • Conservative substitutions: Replace residues with chemically similar amino acids to assess the importance of specific functional groups

    • Non-conservative substitutions: Introduce dramatic changes to test hypotheses about charge, hydrophobicity, or size requirements

  • Expression System Optimization:

    • Use the established E. coli expression system for nuoK , but consider adjusting conditions to accommodate potentially destabilizing mutations

    • Implement a dual-tagging strategy (e.g., N-terminal His-tag with C-terminal FLAG) to verify full-length expression of mutant proteins

  • Functional Characterization Workflow:

Table 4: Comprehensive Functional Analysis of nuoK Mutants

Analysis LevelTechniquesParameters to MeasureControl Comparisons
Expression/SolubilityWestern blot, SDS-PAGEProtein yield, solubility ratioWild-type nuoK, empty vector
Membrane IntegrationMembrane fractionation, protease accessibilityLocalization pattern, topologyWild-type nuoK, known membrane protein
Complex AssemblyBlue native PAGE, co-immunoprecipitationComplex formation, interaction patternWild-type nuoK, partial complex
Enzyme ActivityNADH oxidation assays, electron transfer measurementsActivity rates, substrate affinityWild-type nuoK, inactive mutant
  • Structure-Function Correlation:

    • Map functional effects of mutations onto structural models

    • Identify clusters of functionally important residues that might constitute binding sites or catalytic regions

    • Develop testable hypotheses about mechanism based on mutational patterns

This comprehensive approach allows researchers to systematically dissect the functional architecture of nuoK, identifying key residues involved in catalysis, substrate binding, protein-protein interactions, and membrane integration.

What approaches can be used to study interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex?

Studying the interactions between Methylobacterium nodulans NADH-quinone oxidoreductase subunit K and other components of the complex requires specialized techniques that can capture transient and stable protein-protein interactions within a membrane environment. A multi-faceted approach yields the most comprehensive understanding:

  • In vitro Reconstitution Studies:

    • Co-purification of interacting subunits using tandem affinity tags

    • Reconstitution of partial complexes in liposomes or nanodiscs

    • Activity measurements of reconstituted subcomplexes to assess functional interdependence

  • Crosslinking Approaches:

    • Chemical crosslinking with diverse spacer lengths to capture interactions at different distances

    • Photo-crosslinking with unnatural amino acids incorporated at specific positions in nuoK

    • Mass spectrometry analysis of crosslinked products to identify interacting regions

  • Biophysical Interaction Analysis:

    • Surface plasmon resonance (SPR) with immobilized nuoK to measure binding kinetics

    • Microscale thermophoresis to detect interactions in solution

    • Fluorescence resonance energy transfer (FRET) between labeled subunits to measure proximity

  • Computational Prediction and Validation:

    • Molecular docking simulations to predict interaction interfaces

    • Molecular dynamics simulations to assess stability of predicted complexes

    • Validation of computational predictions through targeted mutagenesis

Table 5: Interaction Analysis Methods for nuoK Studies

MethodAdvantagesLimitationsKey Controls
Co-immunoprecipitationDetects native complexesDetergent may disrupt interactionsIgG control, reverse IP
Chemical crosslinkingCaptures transient interactionsMay introduce artifactsNo-crosslinker control
FRET analysisReal-time monitoring in membraneRequires fluorescent labelingDonor-only, acceptor-only controls
Complementation assaysFunctional validation of interactionIndirect evidencePositive and negative interaction controls
  • Genetic Approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Suppressor mutation analysis to identify compensatory changes

    • Complementation studies with chimeric subunits to map functional interaction domains

By integrating data from multiple complementary approaches, researchers can build a comprehensive model of how nuoK interacts with other components of the NADH-quinone oxidoreductase complex, providing insights into assembly, regulation, and electron transfer mechanisms.

What are common challenges in obtaining functional recombinant nuoK protein and how can they be addressed?

Obtaining functional recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K presents several challenges due to its membrane protein nature. Researchers commonly encounter the following issues, each requiring specific mitigation strategies:

  • Low Expression Levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use specialized strains (e.g., C41/C43 for E. coli), and test different promoter strengths. Consider fusion partners like MBP that can enhance solubility and expression.

  • Protein Misfolding and Aggregation:

    • Challenge: nuoK may form inclusion bodies or aggregate during expression.

    • Solution: Lower induction temperature (16-20°C), reduce inducer concentration, and express in the presence of osmolytes or chaperone co-expression systems. For His-tagged constructs , ensure the tag doesn't interfere with proper folding.

  • Insufficient Membrane Integration:

    • Challenge: Recombinant nuoK may fail to properly insert into membranes.

    • Solution: Use specialized membrane targeting sequences, optimize signal peptide design if necessary, and consider in vitro translation systems with supplied membranes or nanodiscs.

  • Detergent-Mediated Denaturation:

    • Challenge: Harsh detergents may extract the protein but cause loss of structure/function.

    • Solution: Screen multiple detergent types and concentrations (systematic approach):

Table 6: Detergent Optimization for nuoK Extraction

Detergent ClassExamplesTypical Concentration RangeBest For
Mild non-ionicDDM, OG, Digitonin0.5-2% for extraction, 0.05-0.1% for purificationMaintaining native structure
ZwitterionicCHAPS, LDAO0.5-1.5%Efficient extraction with moderate denaturation
Styrene maleic acid copolymersSMA, diisobutylene maleic acid2.5% w/vExtracting native lipid environment
  • Loss of Essential Cofactors or Lipids:

    • Challenge: Function may depend on specific lipids or cofactors lost during purification.

    • Solution: Supplement purification buffers with lipid mixtures, perform purification in the presence of stabilizing ligands, and consider native membrane extraction approaches.

  • Activity Assay Limitations:

    • Challenge: Difficulty distinguishing nuoK-specific activity from background.

    • Solution: Develop assays using purified subcomplexes, create activity-null mutants as negative controls, and measure multiple parameters (electron transfer, proton pumping) for comprehensive functional assessment.

Systematic optimization of each step from construct design through expression, purification, and functional reconstitution is essential for obtaining functional recombinant nuoK protein suitable for detailed biochemical and structural studies.

How does the presence of the His-tag affect nuoK protein function and experimental outcomes?

The presence of a histidine tag on recombinant Methylobacterium nodulans NADH-quinone oxidoreductase subunit K can significantly impact both protein function and experimental results. Understanding these effects is crucial for experimental design and data interpretation:

  • Structural Considerations:

    • The addition of the His-tag (typically 6-10 histidine residues) modifies the N-terminal region of nuoK, potentially affecting local structure

    • For membrane proteins like nuoK, N-terminal tags may interfere with membrane insertion or topology

    • The tag introduces charged residues, which can create artificial electrostatic interactions

  • Functional Implications:

    • Electron Transfer Activity: His-tags near functional domains may impede electron flow through the respiratory complex

    • Complex Assembly: Modified termini might affect interactions with adjacent subunits, altering complex formation efficiency

    • Substrate/Inhibitor Binding: The tag can create steric hindrance or artificial binding sites

  • Experimental Considerations and Mitigation Strategies:

Table 7: Impact of His-Tags on Experimental Outcomes and Mitigation Approaches

Experimental AspectPotential ImpactMitigation StrategyValidation Approach
Purification yieldImproved through affinity chromatographyOptimize elution conditionsCompare yields with different purification approaches
Activity measurementsMay reduce or alter activityInclude tag removal step via protease cleavage siteCompare activity before and after tag removal
Structural studiesCan introduce flexibility or aggregationMove tag position (N vs C-terminal)Test multiple constructs with different tag positions
Binding studiesCan create artificial interactionsUse tag-free protein for final validationControl experiments with scrambled His sequence
  • Empirical Assessment Protocol:

    • Generate both tagged and untagged versions of nuoK when possible

    • Compare activity profiles across different substrate concentrations

    • Assess complex formation efficiency with and without the tag

    • Perform limited proteolysis to determine if the tag affects protein conformation

  • Reporting Standards:

    • Explicitly state tag presence, position, and composition in all methods sections

    • Discuss potential tag effects in data interpretation

    • Include tag sequence in protein sequence information

    • Consider tag effects when comparing results to literature values

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.