Recombinant Methylobacterium nodulans Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kdpC; Mnod_0196; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Target Names
kdpC
Target Protein Sequence
MLQHLRPTLVLGVALTLLTGLAYPLAMTGLAGILFPVEAAGSLVERDGKVVGSRLIGQSF TGDRFFHGRPSATTAPDPTDASKTMPAPYNAANSGGSNLGPTSAALADRVKADVERLRAE NPGAPVPVDLVTTSGSGLDPDISPEAALFQVPRIAKARHLPEERLRDLVAAQVQGRTLGL IGEPRVNVLALNLALDELAGK
Uniprot No.

Target Background

Function

The Recombinant Methylobacterium nodulans Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Methylobacterium nodulans and what makes it unique among methylotrophic bacteria?

Methylobacterium nodulans represents a unique branch within the alpha-2 subclass of Proteobacteria, distinguished as the first and only identified nodulating Methylobacterium species to date . Unlike other methylotrophic bacteria, M. nodulans possesses both the machinery for methanol utilization (a characteristic feature of Methylobacterium genus) and the ability to form nitrogen-fixing nodules with legumes, particularly Crotalaria species . This dual capability makes it exceptionally valuable for studying horizontal gene transfer and bacterial evolution, as phylogenetic analyses indicate that M. nodulans acquired its nodulation capacity through horizontal gene transfer, with its NodA protein being closely related to Bradyrhizobium NodA .

How does the ATPase functionality in Methylobacterium relate to other α-proteobacteria?

The ATPase functionality in Methylobacterium, like other α-proteobacteria, features distinctive regulatory mechanisms that evolved from their free-living ancestors. Alpha-proteobacteria, including Methylobacterium, possess a characteristic ζ subunit that acts as a potent inhibitor of F₁F₀-ATPase . This inhibitory function appears to have been conserved in free-living α-proteobacteria that face broad environmental changes requiring tight regulation of cellular ATP pools . The evolutionary pattern shows that the primary inhibitory function in α-proteobacterial F₁F₀-ATPase was transferred from the ε subunit to the ζ subunit, representing a case of convergent evolution alongside the mitochondrial inhibitory factor IF₁ .

What transformation methods are most effective for introducing recombinant genes into Methylobacterium species?

For successful transformation of Methylobacterium species, electroporation has proven to be an effective method, as demonstrated with Methylobacterium extorquens . The optimal protocol involves applying multiple electric pulses (approximately 10 pulses) with a duration of 300 microseconds at a field strength of 10 kV/cm . This approach has yielded transformation efficiencies of up to 8 × 10³ transformants per microgram of DNA when using broad-host-range plasmids .

For researchers working specifically with M. nodulans, adaptation of these electroporation parameters is recommended, starting with the conditions established for M. extorquens. Additionally, triparental mating represents an alternative method for gene transfer, which has been successfully employed with various Methylobacterium species .

What extrachromosomal elements are suitable for expressing recombinant proteins in Methylobacterium nodulans?

When selecting vectors for expressing recombinant proteins like kdpC in M. nodulans, compatibility of replication elements is a critical consideration. Research has shown that not all replicons function equally well in different Methylobacterium species. Notably, repABC regions from M. nodulans itself (Mnod-1 and Mnod-2) have demonstrated poor compatibility even with the related M. extorquens, with Mnod-2 showing complete incompatibility and Mnod-1 exhibiting high instability and negative effects on growth .

For researchers working with M. nodulans, the following replicon options show greater promise:

Replicon SourceStability (% after 96h)Growth ImpactCopy NumberCompatibility
Mex-DM4 (M. extorquens DM4)97%Minimal1Not compatible with Mrad-JCM
Mrad-JCM (M. radiotolerans)86%Minimal1Not compatible with Mex-DM4
Nham-3 (N. hamburgensis)77%Minimal1Compatible with both Mex-DM4 and Mrad-JCM

These three replicon systems can be used to construct mini-chromosomes that are stably inherited at single copy number and can be shuttled between E. coli and Methylobacterium species . When designing expression systems for recombinant kdpC, these mini-chromosomal elements can be coupled with appropriate promoters, such as the cumate-inducible promoter system, which offers a wide expression range .

How can researchers optimize codon usage for recombinant kdpC expression in Methylobacterium nodulans?

Optimizing codon usage is essential for efficient expression of recombinant proteins in Methylobacterium. For kdpC expression in M. nodulans, researchers should consider the following methodological approach:

  • Analyze the native codon usage pattern of highly expressed genes in M. nodulans using available genomic data

  • Modify the kdpC coding sequence to match preferred codons while preserving the amino acid sequence

  • Pay particular attention to rare codons that might cause translational pausing or premature termination

  • Consider the GC content of M. nodulans (typically around 65-70% for Methylobacterium species) when designing synthetic genes

The optimization strategy should avoid introducing rare codons or unfavorable codon pairs that might impede translation efficiency. For heterologous expression of kdpC, codon adaptation index (CAI) values above 0.8 should be targeted for optimal expression levels.

What are the key structural and functional domains of kdpC that should be preserved when creating recombinant constructs?

When designing recombinant constructs of M. nodulans kdpC, researchers must preserve critical structural and functional elements:

  • The N-terminal transmembrane helix that anchors kdpC to the membrane

  • The C-terminal domain that interacts with kdpB (the catalytic subunit)

  • Residues involved in stabilizing the kdpABC complex

Fusion tags for purification or detection should be carefully positioned to avoid disrupting these critical regions. For most applications, C-terminal tags are preferable as they are less likely to interfere with membrane insertion and complex assembly. If N-terminal tagging is necessary, consider incorporating a flexible linker sequence to minimize disruption of protein folding.

What purification strategies are most effective for isolating recombinant kdpC from Methylobacterium nodulans?

Purifying membrane-associated proteins like kdpC from Methylobacterium presents unique challenges. A systematic purification approach includes:

  • Membrane fraction isolation

    • Harvest cells during mid-logarithmic growth phase

    • Disrupt cells using French press (15,000 psi) or sonication in buffer containing 50 mM Tris-HCl pH 7.5, 250 mM sucrose, 10 mM MgCl₂

    • Remove unbroken cells and debris by centrifugation (10,000 × g, 10 min)

    • Isolate membrane fraction by ultracentrifugation (150,000 × g, 1 hour)

  • Solubilization

    • Resuspend membrane pellet in solubilization buffer (20 mM Tris-HCl pH 7.5, 10% glycerol, 1 mM DTT)

    • Add detergent (recommended starting points: 1% n-dodecyl-β-D-maltoside or 1% digitonin)

    • Incubate with gentle agitation for 1 hour at 4°C

    • Remove insoluble material by ultracentrifugation (150,000 × g, 30 min)

  • Affinity purification (assuming His-tagged construct)

    • Apply solubilized material to Ni-NTA column equilibrated with wash buffer (20 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 0.05% detergent, 20 mM imidazole)

    • Wash extensively to remove non-specifically bound proteins

    • Elute with imidazole gradient (50-300 mM)

    • Analyze fractions by SDS-PAGE and Western blotting

  • Further purification

    • Size exclusion chromatography to separate monomeric kdpC from aggregates or complexes

    • Ion exchange chromatography for additional purity if required

For functional studies, consider purifying the entire kdpABC complex rather than isolated kdpC to maintain native interactions and activity.

How can researchers assess the functional integrity of recombinant kdpC in vitro?

Verifying the functional integrity of recombinant kdpC involves assessing both its ability to form proper complexes with kdpA and kdpB subunits and the functionality of the assembled complex. The following methodological approaches are recommended:

  • Complex formation analysis

    • Co-immunoprecipitation using antibodies against kdpC or affinity tags

    • Blue Native PAGE to visualize intact kdpABC complexes

    • Crosslinking studies to capture transient interactions

  • ATPase activity assays

    • Measure ATP hydrolysis using colorimetric phosphate release assays

    • Compare activity with and without potassium to assess specific activation

    • Perform kinetic analyses to determine Km and Vmax values

    • Test inhibition with known P-type ATPase inhibitors (e.g., vanadate)

  • Potassium transport assays

    • Reconstitute purified kdpABC complex into proteoliposomes

    • Measure ⁸⁶Rb⁺ uptake as a tracer for K⁺ transport

    • Monitor K⁺ accumulation using potassium-sensitive fluorescent dyes

    • Assess the effect of membrane potential on transport rates

These functional assays should be performed with appropriate controls, including site-directed mutants with known effects on activity to validate the experimental system.

How can researchers exploit the unique characteristics of M. nodulans for studying horizontal gene transfer?

M. nodulans presents a valuable model system for investigating horizontal gene transfer (HGT) mechanisms due to its acquisition of nodulation genes from other rhizobia. Researchers can leverage this natural phenomenon through these methodological approaches:

  • Comparative genomic analysis

    • Sequence and analyze the genomic context surrounding the nodA gene in M. nodulans

    • Identify genomic islands, insertion sequences, or other mobile genetic elements that may have facilitated HGT

    • Compare sequence signatures of potential horizontally acquired regions with core genome sequences

  • Experimental evolution studies

    • Design selection schemes to promote further gene acquisition

    • Monitor adaptation to new host plants or environmental conditions

    • Sequence evolving populations to track genomic changes in real-time

  • Mechanistic investigations

    • Create reporter systems to detect transfer events

    • Test the role of stress conditions in promoting gene transfer

    • Investigate potential transfer mechanisms (transformation, conjugation, transduction)

The unique evolutionary history of M. nodulans, which shows evidence of acquiring nodulation genes from Bradyrhizobium, provides insights into how metabolic capabilities can be expanded through HGT events . This makes M. nodulans particularly valuable for studying the mechanisms and ecological consequences of gene transfer in bacterial populations.

What is the relationship between potassium homeostasis and symbiotic nitrogen fixation in M. nodulans?

The potassium-transporting ATPase, including the kdpC component, plays crucial roles in bacterial osmoregulation and may influence symbiotic interactions. For researchers investigating this relationship, consider these methodological approaches:

  • Gene expression analysis

    • Compare kdpC expression levels in free-living versus symbiotic states

    • Analyze expression during different stages of nodule development

    • Perform transcriptome analysis under varying potassium concentrations

  • Mutant phenotyping

    • Create kdpC deletion or point mutants using CRISPR-Cas systems adapted for Methylobacterium

    • Assess nodulation efficiency, nitrogen fixation rates, and plant growth promotion

    • Evaluate competitive fitness against wild-type strains in planta

  • In situ visualization

    • Use fluorescent protein fusions to track KdpC localization during symbiosis

    • Employ electron microscopy to examine ultrastructural changes in mutants

    • Measure potassium fluxes in nodules using ion-selective microelectrodes

Understanding the intersection between potassium homeostasis and symbiotic function could reveal new aspects of plant-microbe interactions and potentially lead to improved nitrogen-fixing symbionts for agricultural applications.

How can researchers address expression problems with recombinant kdpC in Methylobacterium nodulans?

When encountering difficulties with kdpC expression, consider this systematic troubleshooting approach:

  • Promoter selection

    • Test multiple promoters with different strengths and induction characteristics

    • Consider native M. nodulans promoters for homologous expression

    • For heterologous promoters, the cumate-inducible system has shown promise in Methylobacterium, potentially offering expression levels exceeding other available systems

  • Codon optimization

    • Check for rare codons that might cause translational pauses

    • Optimize GC content to match M. nodulans preferences

    • Consider using synthetic gene constructs with optimized sequences

  • Growth conditions

    • Optimize temperature, as lower temperatures may improve folding of membrane proteins

    • Adjust induction timing to coincide with mid-logarithmic growth

    • Test different carbon sources, as methylotrophic metabolism may influence expression

  • Construct design

    • Include appropriate signal sequences if targeting to the membrane is problematic

    • Test different fusion tags if protein detection is challenging

    • Consider expressing kdpC as part of the native kdpABC operon to maintain proper stoichiometry

If instability of the expression vector is observed, consider using the more stable replicons identified for Methylobacterium, such as Mex-DM4, Mrad-JCM, or Nham-3, which demonstrate stability values of 97%, 86%, and 77% respectively after 96 hours of growth without selection pressure .

What strategies can overcome the challenges of protein solubility and membrane integration for recombinant kdpC?

As a membrane protein component, kdpC presents specific challenges related to proper folding and membrane integration. Researchers should consider:

  • Expression temperature modulation

    • Lower temperatures (16-25°C) often improve membrane protein folding

    • Implement a temperature shift strategy: grow at 30°C until induction, then shift to 18°C

  • Detergent screening

    • Test a panel of detergents for optimal solubilization

    • Consider mild detergents like digitonin or LMNG for maintaining native interactions

    • Use systematic detergent screening approaches with stability assays

  • Co-expression strategies

    • Express kdpC together with kdpA and kdpB to promote proper complex formation

    • Include chaperone proteins to assist folding

    • Consider co-expression with assembly factors specific to P-type ATPases

  • Alternative expression hosts

    • If expression in M. nodulans proves challenging, consider closely related species

    • Test expression in M. extorquens, which has well-established genetic tools

    • For structural studies, specialized expression systems like Escherichia coli strains with enhanced membrane protein expression capabilities may be beneficial

A methodical approach combining these strategies will help overcome the inherent challenges of membrane protein expression and purification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.