Recombinant Methylobacterium nodulans Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Role in Methylotrophy and Symbiosis

  • Methylotrophy: M. nodulans uses ctaB to sustain methanol metabolism, a hallmark of methylotrophic bacteria . The enzyme ensures efficient electron transport during methanol oxidation by maintaining functional COX .

  • Symbiotic Nitrogen Fixation: ctaB supports root nodule formation in legumes (e.g., Crotalaria spp.) by enabling energy-intensive nitrogenase activity . Strains lacking ctaB show reduced nodulation efficiency .

Expression Systems

  • Yeast-Based Production: Recombinant ctaB is synthesized in yeast with a 50% glycerol stabilizer, achieving yields of 0.1–1.0 mg/mL .

  • Tagging: Affinity tags (e.g., His-tag) are incorporated during manufacturing for purification .

Industrial and Agricultural Relevance

ApplicationDetails
BioenergyEnhances methanol-to-biofuel conversion efficiency in engineered strains .
AgricultureImproves nitrogen-fixing capacity in symbiotic biofertilizers .
BioremediationPotential role in degrading chlorinated methane compounds .

Research Challenges and Innovations

  • Thermostability: Lyophilized recombinant ctaB has a 12-month shelf life but degrades upon repeated freeze-thaw cycles .

  • Functional Redundancy: Some Methylobacterium strains (e.g., group C) lack alternative heme biosynthesis pathways, making ctaB indispensable .

  • Genomic Insights: Phylogenomic analyses classify M. nodulans within Methylobacterium group C, which shows unique adaptations for plant interactions .

Comparative Genomics

  • Conservation: ctaB homologs are present in Bradyrhizobium and Rhodopseudomonas, but M. nodulans retains unique regulatory elements for symbiotic functions .

  • Evolution: Horizontal gene transfer of ctaB among Alphaproteobacteria is rare, suggesting vertical inheritance in Methylobacterium .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ctaB; Mnod_0262; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Target Names
ctaB
Target Protein Sequence
MTSLTNSLNPAQTLAPASNGDVADFFALLKPRVMALVVFTALVGMTVSPSHVNPVIGAVS LLMIAVGAGASGCLNMWWDADIDAVMTRTRSRPIPAGRIRPEEALTFGLVLAVGSVLMLG LAANWLAAGLLAFTIVFYTVIYSMWLKRATAQNIVIGGAAGALPPMIGQAVVTGSVGIEG IILFLIIFIWTPPHFWALALVKSADYAKAGIPMMPNVAGPDSTRRQIVGYTLLLAPLGLA PVALGFGGLIYGLVALLGGLAMLVLSLQVHRRREGESADKAAMSLFGFSILYLFLLFSAL LAEQGLGLMRPIPVLLG
Uniprot No.

Target Background

Function
Converts heme B (protoheme IX) to heme O by substituting the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links
Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX farnesyltransferase (ctaB) and what is its primary function in bacterial systems?

Protoheme IX farnesyltransferase (ctaB) is a membrane-bound enzyme that catalyzes a critical step in bacterial heme biosynthesis. Specifically, it transfers a farnesyl group to protoheme IX, producing heme O, an essential precursor for terminal oxidases in the bacterial respiratory chain . The protein contains a putative allylic polyprenyldiphosphate binding domain that is crucial for its enzymatic activity . In Methylobacterium nodulans, ctaB is encoded by the ordered locus name Mnod_0262 and plays a vital role in cellular respiration and energy metabolism .

What are the optimal conditions for expression and purification of recombinant M. nodulans ctaB?

For optimal expression and purification of recombinant M. nodulans ctaB:

Expression System:

  • E. coli expression systems are generally preferred, with BL21(DE3) strains showing good results

  • Expression vectors containing T7 or tac promoters with appropriate tags (His, GST) facilitate purification

Growth Conditions:

  • Culture in LB medium supplemented with appropriate antibiotics

  • Induce at OD600 of 0.6-0.8 with IPTG (0.1-0.5 mM)

  • Post-induction growth at 18-25°C for 16-18 hours to minimize inclusion body formation

Purification Protocol:

  • Due to its membrane nature, detergent-based extraction using mild detergents (DDM, LDAO) is essential

  • Purify using affinity chromatography with Tris-based buffer containing 50% glycerol

  • Store at -20°C for short-term or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week

How can researchers effectively create and validate ctaB knockout mutants?

Creating and validating ctaB knockout mutants requires a systematic approach:

Knockout Strategy:

  • Design gene deletion constructs with homologous flanking regions (~1kb upstream and downstream of ctaB)

  • Use suicide vectors that cannot replicate in the target organism

  • Select transformants on appropriate antibiotic media

Validation Methods:

  • PCR Verification: Primers spanning the deletion junction to confirm gene removal

  • RT-PCR: To verify absence of ctaB transcript

  • Functional Assays: Measure respiratory activity using oxygen consumption assays

  • Phenotypic Analysis: Compare growth rates, pigmentation, and stress tolerance to wild-type strains

  • Complementation: Reintroduce ctaB on a plasmid to restore wild-type phenotype, confirming specificity of the knockout effects

Example from S. aureus Research:
Researchers created a ctaB mutant in MRSA strain USA500, validating it through growth rate monitoring, pigment production assays, and virulence testing in mice . This approach demonstrated that deletion caused growth attenuation and virulence reduction but enhanced pigment production.

How does ctaB influence bacterial respiration and what phenotypic changes occur when ctaB is deleted?

The ctaB protein plays a crucial role in bacterial respiration by synthesizing heme O, an essential component of terminal oxidases. When ctaB is deleted, several significant phenotypic changes occur:

Respiratory Effects:

  • Disruption of the electron transport chain

  • Reduced ATP synthesis capacity

  • Metabolic reprogramming toward alternative energy pathways

Observed Phenotypic Changes:

ParameterWild-typeΔctaB MutantComplemented Strain
Growth RateNormalAttenuatedRestored
Virulence in MiceHighSignificantly reducedPartially restored
Pigment ProductionNormalEnhancedNormalized
Persister Cell FormationNormalIncreased (with quinolones)Reduced

In S. aureus, ctaB deletion significantly down-regulated 20 ribosomal genes and 24 genes involved in amino acid biosynthesis, indicating widespread metabolic changes . These findings demonstrate that ctaB influences not only respiration but also broader aspects of bacterial physiology and virulence.

What is the relationship between ctaB function and bacterial stress responses?

CtaB function is integrally connected to bacterial stress responses through several mechanisms:

Oxidative Stress Adaptation:

  • As part of the respiratory chain, ctaB indirectly affects reactive oxygen species (ROS) production

  • Deletion mutants often show altered susceptibility to oxidative stressors

Antibiotic Tolerance:

  • In S. aureus, ctaB deletion enhanced formation of quinolone-tolerant persister cells

  • This persister formation was specific to fluoroquinolone antibiotics (ciprofloxacin, levofloxacin) rather than other antibiotic classes

Transcriptional Regulation:

  • Deletion of ctaB triggers expression changes in stress-response genes

  • RNA-seq analysis revealed that ctaB deletion in S. aureus induced expression of five two-component systems, including PhoPR, LgrAB, SaeRS, and LytSR, suggesting these systems might be activated when heme biosynthesis is impaired

These findings indicate that ctaB plays an important role in bacterial adaptation to environmental stressors, particularly those affecting cellular respiration and membrane integrity.

How can ctaB be effectively used in genetic engineering applications, particularly for extrachromosomal element design?

The ctaB gene can be strategically utilized in genetic engineering applications, particularly for designing stable extrachromosomal elements:

Mini-Chromosome Construction:
When constructing mini-chromosomes for Methylobacterium species, the repABC regions containing ctaB have been systematically evaluated. Research has shown that:

  • Some repABC regions from M. nodulans (specifically Mnod-1) exhibit very poor compatibility with M. extorquens, showing instability and affecting growth rates

  • The Mnod-2 repABC region containing ctaB showed complete incompatibility, with no colonies obtained after electroporation

Design Considerations:
For effective use of ctaB in genetic constructs:

  • Incorporate strong transcriptional terminators to insulate ctaB from nearby genetic elements

  • Position the antibiotic resistance cassette downstream and in the same orientation as the ctaB transcriptional unit

  • Consider compatibility issues when introducing ctaB-containing constructs into related Methylobacterium species

Application in Functional Studies:
The ctaB gene can serve as a selective marker in genetic constructs, as its deletion creates distinct phenotypes that can be complemented by the wild-type gene, providing a clean system for functional studies .

What approaches can be used to study ctaB expression under different environmental conditions?

Studying ctaB expression under varying environmental conditions requires multiple complementary approaches:

Transcriptional Analysis:

  • RNA-seq: For genome-wide expression profiling (as used in S. aureus ctaB studies)

  • qRT-PCR: For targeted quantification of ctaB transcripts under specific conditions

  • Promoter-reporter fusions: Using fluorescent proteins or luciferase to monitor promoter activity in real-time

Protein-Level Analysis:

  • Western blotting: Using antibodies against ctaB or epitope tags

  • Proteomics: MS/MS analysis to quantify relative protein abundance

  • Activity assays: Measure enzymatic activity directly using substrate conversion assays

Example Experimental Design:

ConditionMethodParameter MeasuredExpected Outcome
Oxygen limitationqRT-PCR, RNA-seqTranscript levelsIncreased expression
Heme supplementationWestern blotProtein levelsDecreased expression (feedback)
Growth phaseReporter fusionPromoter activityHigher in exponential phase
Temperature stressActivity assayEnzyme functionReduced at non-optimal temperatures

For validation of results, researchers should include appropriate housekeeping genes (such as 16S rRNA or gyrB) as internal controls and perform complementation studies to confirm observations.

How does ctaB from M. nodulans compare structurally and functionally with homologs in other bacterial species?

The ctaB protein shows interesting structural and functional variations across bacterial species:

Sequence Comparison:
When comparing M. nodulans ctaB with homologs in other bacteria, key differences emerge in:

  • Transmembrane domain organization

  • Active site residues

  • Substrate binding pocket

The most extensively studied homolog is in S. aureus, where ctaB plays a critical role in virulence and persistence . In E. coli, the homologous gene cyoE has been characterized as essential for heme O biosynthesis and proper functioning of the cytochrome bo complex .

Evolutionary Implications:
Phylogenomic analysis suggests that heme biosynthesis genes like ctaB were present in the last bacterial common ancestor (LBCA) , indicating their ancient evolutionary origin and fundamental importance to bacterial physiology.

What are the advanced methodological approaches for investigating ctaB involvement in bacterial biofilm formation and community interactions?

Investigating ctaB's role in biofilm formation and community interactions requires sophisticated methodological approaches:

Biofilm Analysis Techniques:

  • Confocal Laser Scanning Microscopy (CLSM): To visualize biofilm architecture with fluorescently labeled strains

  • Crystal Violet Assays: For quantitative measurement of biofilm biomass

  • BioFlux Systems: For studying biofilm formation under controlled flow conditions

Community Interaction Studies:

  • Metagenomic Analysis: To determine ctaB prevalence and expression in natural bacterial communities

  • Co-culture Experiments: Comparing wild-type and ΔctaB mutant interactions with other bacterial species

  • Metabolomic Profiling: To identify metabolites exchanged between community members that may be influenced by ctaB function

Advanced Experimental Approaches:
Research on thermoacidophilic biofilm communities has demonstrated that combining metagenomic assembly, binning techniques, and metabolic potential assessment can reveal complex trophic relationships within bacterial communities . Similar approaches can be applied to study how ctaB impacts:

  • Carbon and energy flow within bacterial communities

  • Formation of structured bacterial consortia

  • Resilience to environmental stressors

  • Interspecies signaling and cooperation

Such studies would benefit from tools like MicroState, which approximates community structure by predicting trophic states using genomic data , allowing researchers to model how ctaB expression influences community dynamics.

What role does ctaB play in the plant-associated lifestyle of Methylobacterium nodulans?

Methylobacterium nodulans is unique as the only nodulating Methylobacterium species identified to date , making its ctaB potentially important in plant-microbe interactions:

Respiratory Support for Symbiosis:

  • As a key enzyme in respiratory chain synthesis, ctaB likely supports the high energy demands of symbiotic nitrogen fixation

  • Efficient respiration is crucial during nodule formation and maintenance

Connection to Plant Hormone Production:

  • Methylobacterium species produce phytohormones including cytokinins (CKs) that promote plant growth

  • While not directly involved in hormone biosynthesis, ctaB's role in energy metabolism may indirectly affect the bacterium's capacity for hormone production

Research from Related Systems:
Studies of Methylobacterium species associated with rice plants have revealed:

  • Substantial variability in carbon use profiles among strains

  • Host-specific relationships influenced by plant landraces rather than geography

  • Enhanced early growth advantages for plants colonized by specific Methylobacterium strains

These findings suggest that respiratory efficiency, potentially impacted by ctaB function, may influence the success of plant-Methylobacterium associations.

How can researchers investigate the impact of ctaB mutations on Methylobacterium-plant interactions?

Investigating ctaB's role in plant-microbe interactions requires specialized methodological approaches:

Plant Inoculation Experiments:

  • Surface-sterilize plant seeds (e.g., using 70% ethanol, sodium hypochlorite)

  • Inoculate with wild-type, ΔctaB mutant, and complemented strains

  • Monitor plant growth parameters (height, biomass, chlorophyll content)

  • Quantify bacterial colonization of plant tissues using selective plating or qPCR

Sample Experimental Design:

TreatmentMeasurement ParametersTimepoints (days)Expected Outcomes
Wild-type M. nodulansPlant height, colonization7, 14, 21, 40Normal growth, high colonization
ΔctaB mutantPlant height, colonization7, 14, 21, 40Reduced growth, lower colonization
Complemented strainPlant height, colonization7, 14, 21, 40Restored growth, improved colonization
Uninoculated controlPlant height7, 14, 21, 40Baseline growth

Advanced Analytical Approaches:

  • Confocal microscopy with fluorescently tagged bacteria to visualize colonization patterns

  • Transcriptomic analysis of both plant and bacterial genes during interaction

  • Metabolomic profiling to detect changes in plant exudates and bacterial metabolites

  • Hormone quantification using HPLC-MS/MS to measure phytohormone production

Such comprehensive approaches would help elucidate whether ctaB mutations affect the plant growth-promoting capabilities of M. nodulans through altered respiration efficiency, colonization ability, or metabolite exchange.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.