Recombinant Methylobacterium populi ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Description

Overview of ATP Synthase and Subunit Function

ATP synthase, also known as F1FO-ATPase, is a vital enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency in living organisms . It is found in the membranes of bacteria, mitochondria, and chloroplasts . The enzyme consists of two main parts: the F1 domain, which is responsible for ATP hydrolysis and synthesis, and the FO domain, which is embedded in the membrane and involved in proton translocation .

The ATP synthase complex comprises several subunits, each with specific roles :

  • α and β Subunits: Located in the F1 domain, these subunits are crucial for ATP synthesis and hydrolysis. The β subunits contain the catalytic sites where ATP is produced .

  • γ, δ, and ε Subunits: These also reside in the F1 domain and form the central stalk. The γ subunit rotates within the α3β3 hexamer, driving ATP synthesis .

  • a, b, and c Subunits: Found in the FO domain, these subunits facilitate proton translocation across the membrane, providing the energy for ATP synthesis. The 'c' subunits form a ring that rotates as protons flow through it .

  • b/b' Subunits: Part of the peripheral stalk, these connect the F1 and FO domains, stabilizing the entire complex .

Recombinant Production

Recombinant ATP synthase subunits, such as the b/b' subunit (atpG) from Methylobacterium populi, are produced using genetic engineering techniques. This involves cloning the gene encoding the subunit into an expression vector, introducing the vector into a host organism (e.g., E. coli), and inducing the host to produce the protein . The recombinant protein can then be purified for structural and functional studies .

Table 1: Recombinant Production Overview

StepDescription
Gene CloningThe atpG gene from Methylobacterium populi is isolated and inserted into an expression vector.
TransformationThe expression vector is introduced into a host organism like E. coli.
Protein ExpressionThe host organism is cultured under conditions that induce the expression of the atpG gene.
PurificationThe recombinant b/b' subunit is isolated and purified from the host cell lysate.

Functional Role of the b/b' Subunit

The b/b' subunits play a crucial role in stabilizing the ATP synthase complex and facilitating its function . They connect the F1 and FO domains, ensuring that the energy from proton translocation is efficiently coupled to ATP synthesis .

  • Stabilization: The peripheral stalk, including the b/b' subunits, holds the F1 and FO domains together, preventing dissociation of the complex .

  • Proton Pathway Integrity: The b/b' subunits help maintain the structural integrity of the transmembrane proton pathway, ensuring efficient proton translocation .

  • Regulation: The b/b' subunits, along with other subunits like ε and the αCTD, are involved in regulating ATP hydrolysis and preventing ATP wastage under low-energy conditions .

Research Findings

Research on ATP synthase has provided insights into its structure, function, and regulation. Studies on mycobacterial ATP synthase have revealed unique features that could be targeted for developing new anti-tuberculosis drugs .

  • Auto-inhibition: Mycobacterial ATP synthase has auto-inhibitory mechanisms involving the C-terminal region of the α-subunit and the b′-subunit in the peripheral stalk, which prevent ATP hydrolysis under low-energy conditions .

  • Drug Binding Sites: The structure of M. smegmatis ATP synthase with bedaquiline, an anti-tuberculosis drug, shows that the drug binds at the interface of subunits a and c, inducing conformational changes that inhibit ATP synthesis .

  • Latent ATPase Activity: Mycobacterial ATP synthases exhibit latent ATPase activity, which prevents the establishment of a significant proton gradient during ATP hydrolysis, thus maintaining ATP homeostasis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; Mpop_3368; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Target Names
atpF2
Target Protein Sequence
MAEQNILTTPSPNADTTIVPPGSPHTHTEQPSGGHGGAFPPFESHTFLAQLIWLALAFGL LYYLMSKVALPRIEAILGDRAGRLSSDLNEAQRMKAEADAAGAAYETSLREAQAKAQAIA QETRNSLSAEADAKRKTLEAELNQRLAASEATIRARTSEAMGNVRTIAGETASAIVERLT GQAPDQASLNRALDATPAVH
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These are linked by a central and peripheral stalk. ATP synthesis in the F(1) domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b'-subunit, a divergent duplicate of the b subunit found in plants and photosynthetic bacteria, is a component of the F(0) channel and part of the peripheral stalk, connecting F(1) and F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Methylobacterium populi and what are its key genomic characteristics?

Methylobacterium populi is a bacterial species belonging to the Methylobacteriaceae family. Comprehensive phylogenomic analysis has revealed that Methylobacterium contains four evolutionarily distinct groups (A, B, C, and D), each characterized by different genome sizes, GC content, and environmental sources . M. populi is particularly notable for its diverse metabolic capabilities, including the degradation of various xenobiotic compounds.

Strains like M. populi YC-XJ1 have been isolated from desert soil and exhibit exceptional biodegrading abilities toward multiple compounds, including aromatic oxyphenoxypropionic acid esters, phthalate esters, organophosphorus flame retardants, and other environmental pollutants . Genome analysis shows that M. populi contains a large number of exogenous compound degradation pathways and hydrolase resources, making it a promising candidate for bioremediation applications .

What is the function of ATP synthase in bacteria like Methylobacterium populi?

ATP synthase in bacteria, including Methylobacterium populi, serves as a crucial molecular machine that produces ATP from ADP and inorganic phosphate using energy derived from a transmembrane proton motive force . This enzyme operates as a rotary nanomotor, utilizing the energy from proton translocation across the membrane to drive the synthesis of ATP, which serves as the primary energy currency for cellular processes.

The ATP synthase complex in bacteria performs the essential function of energy conservation through oxidative phosphorylation. During respiration, bacteria establish a proton gradient across the membrane, and ATP synthase harnesses this electrochemical gradient to catalyze ATP synthesis, enabling cellular metabolism and growth .

What is the structural composition of bacterial ATP synthase complexes?

Bacterial ATP synthases are the simplest form of this enzyme complex, consisting of two major portions:

  • F₁ portion (soluble): Contains the catalytic machinery for ATP synthesis, typically composed of five subunits (α, β, γ, δ, and ε) in a stoichiometry of α₃β₃γδε.

  • F₀ portion (membrane-embedded): Forms the proton channel and typically contains three subunits (a, b, and c) with a stoichiometry of ab₂c₈-15 (the number of c subunits varies between species).

The structure determined through cryo-EM imaging of bacterial ATP synthases reveals the intricate architecture enabling proton translocation through the membrane region and the mechanism by which this translocation is coupled to ATP synthesis . The central stalk (γ and ε subunits) connects the F₁ and F₀ portions, while the peripheral stalk (including subunit b/b') serves as a stator, preventing rotation of the α₃β₃ assembly during catalysis .

What specific role does the b/b' (atpG) subunit play in bacterial ATP synthase function?

The b/b' subunits (encoded by atpG) form a critical component of the peripheral stalk (or stator) in bacterial ATP synthases. This peripheral stalk serves several essential functions:

  • Acts as a structural anchor between the F₁ and F₀ portions

  • Prevents the rotation of the α₃β₃ hexamer during catalysis

  • Helps maintain the proper alignment of the enzyme complex

  • Contributes to the stability of the entire ATP synthase assembly

In many bacteria, including Methylobacterium species, the peripheral stalk consists of dimeric b subunits (b/b' heterodimer), which form an extended coiled-coil structure that spans from the membrane to the top of the F₁ portion . This structure allows the enzyme to withstand the torque generated during rotational catalysis.

What expression systems are most effective for producing recombinant Methylobacterium populi ATP synthase subunit b/b'?

The selection of appropriate expression systems for recombinant Methylobacterium populi ATP synthase subunit b/b' depends on several factors, including protein solubility, post-translational modifications, and functional requirements. Based on current recombinant protein expression technologies, the following systems show promise:

Table 1: Comparison of Expression Systems for Recombinant ATP Synthase Subunits

Expression SystemAdvantagesLimitationsRecommended Tags
E. coli (BL21(DE3))High yield, economical, rapid expressionLimited post-translational modificationsHis, MBP, GST
Yeast (P. pastoris)Higher eukaryotic modifications, good foldingLower yields than E. coliHis, FLAG
Insect cells (Sf9)Complex protein folding, good for membrane proteinsHigher cost, longer expression timeHis, Strep
Mammalian cellsNative-like folding and modificationsHighest cost, complex protocolsHis, FLAG, GFP

For bacterial ATP synthase subunits, E. coli expression systems often provide sufficient yield and proper folding, particularly when employing fusion tags that enhance solubility . The addition of a His-tag typically facilitates purification without significantly affecting function. For difficult-to-express constructs, maltose-binding protein (MBP) fusion can enhance solubility while maintaining proper folding .

What are the most effective purification strategies for recombinant ATP synthase subunits from Methylobacterium populi?

Purifying recombinant ATP synthase subunits presents several challenges due to their hydrophobic nature and tendency to form aggregates. A multi-step purification approach is typically recommended:

  • Initial Capture: Affinity chromatography using the fusion tag (e.g., IMAC for His-tagged proteins)

  • Intermediate Purification: Ion exchange chromatography to separate based on charge properties

  • Polishing: Size exclusion chromatography to obtain homogeneous protein and remove aggregates

For membrane-associated subunits like b/b', the use of appropriate detergents during cell lysis and throughout purification is critical. Non-ionic detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) typically preserve protein structure and function .

For researchers seeking high purity (>95%), additional steps such as tag removal via specific proteases followed by reverse affinity chromatography may be necessary . Protein reprocessing techniques including renaturation and endotoxin removal can be applied for preparations requiring higher purity or specific downstream applications .

How can site-directed mutagenesis be applied to study structure-function relationships in the atpG subunit?

Site-directed mutagenesis represents a powerful approach for investigating the structural determinants of atpG function in ATP synthase. Strategic mutations can reveal:

  • Interface Residues: Mutations at predicted interaction surfaces between b/b' and other subunits can identify critical contact points

  • Dimerization Domains: Alterations in the coiled-coil regions can reveal residues essential for b/b' dimerization

  • Membrane Association: Mutations in transmembrane regions can clarify anchoring mechanisms

  • Functional Coupling: Specific residues may be involved in transmitting conformational changes between F₀ and F₁ portions

When designing mutagenesis experiments, researchers should consider:

  • Conservation analysis across Methylobacterium species and other bacteria

  • Structural predictions based on homology to characterized ATP synthases

  • Charge distribution and potential electrostatic interactions

  • Hydrophobicity patterns and membrane interaction domains

After mutagenesis, functional assays should assess both ATP synthesis and hydrolysis activities, as certain mutations may differentially affect these activities, similar to the regulatory effects observed with subunit ε .

What structural adaptations exist in the ATP synthase of Methylobacterium compared to other bacterial species?

The structural adaptations in Methylobacterium ATP synthase likely reflect its evolutionary history and ecological niche. While specific structural data for Methylobacterium populi ATP synthase is limited, comparative genomic analysis suggests potential adaptations:

  • Environmental Adaptations: As Methylobacterium species are often associated with plant surfaces (particularly group A and D species, with 62% and 75% isolated from plants, respectively), their ATP synthases may have adaptations for functioning in fluctuating pH environments typical of plant surfaces .

  • Phylogenetic Variations: The four distinct evolutionary groups of Methylobacterium (A-D) likely exhibit variations in their ATP synthase components, potentially relating to their different environmental sources - from phyllosphere to soil and water sediments .

  • Proton Channel Architecture: The proton translocation pathway through the membrane region may contain species-specific adaptations that optimize function under different environmental conditions .

Future structural studies using cryo-EM or X-ray crystallography would be valuable for identifying the unique features of Methylobacterium populi ATP synthase compared to the structures determined for other bacterial species like Bacillus PS3 .

What advanced biophysical techniques are most informative for characterizing recombinant ATP synthase subunits?

Multiple biophysical approaches can provide complementary insights into the structural and functional properties of recombinant ATP synthase subunits:

Table 2: Advanced Biophysical Techniques for ATP Synthase Characterization

TechniqueInformation ProvidedSample RequirementsResolution
Cryo-EM3D structure, conformational states2-5 mg purified proteinNear-atomic (2-4 Å)
X-ray CrystallographyAtomic structure, binding sitesDiffraction-quality crystalsAtomic (1-3 Å)
Nuclear Magnetic ResonanceSolution structure, dynamics15N/13C labeled proteinAtomic for small domains
Hydrogen-Deuterium Exchange MSConformational dynamics, interfaces50-100 μg proteinPeptide-level
Surface Plasmon ResonanceBinding kinetics, affinitiesImmobilized protein partnerN/A
Circular DichroismSecondary structure content0.1-1 mg/ml protein solutionLow resolution

Cryo-EM has proven particularly valuable for ATP synthase structural studies, revealing rotational states and providing insights into the inhibitory mechanisms of regulatory subunits such as subunit ε . The technique has allowed researchers to build atomic models of bacterial ATP synthase complexes in different rotational states, revealing the path of transmembrane proton translocation .

For specific subunits like b/b', a combination of techniques is often most informative. For example, circular dichroism can confirm the predicted α-helical content of the coiled-coil domains, while cross-linking mass spectrometry can identify interaction surfaces with neighboring subunits.

How does the enzymatic activity of Methylobacterium populi ATP synthase compare to other bacterial species?

The enzymatic parameters of recombinant ATP synthase components can provide valuable insights into species-specific adaptations. While specific kinetic data for Methylobacterium populi ATP synthase is not available in the provided search results, comparative enzymatic studies typically assess:

  • ATP Synthesis Rate: Measured using luciferin/luciferase assays under defined proton gradient conditions

  • ATP Hydrolysis Rate: Typically measured via phosphate release assays

  • Proton Pumping Efficiency: The H⁺/ATP ratio, which may vary between bacterial species

  • Regulatory Properties: Inhibition mechanisms and response to environmental factors

For comparison, enzymatic studies of hydrolases from Methylobacterium populi YC-XJ1 have demonstrated specific activities of recombinant enzymes. For example, the QPE-degrading enzyme QPEH2 showed a specific activity of 0.1 ± 0.02 U mg⁻¹ with kcat/Km values of 1.8 ± 0.016 mM⁻¹·s⁻¹, while the DEP-degrading enzyme DEPH1 exhibited a specific activity of 0.1 ± 0.02 U mg⁻¹ with kcat/Km values of 0.8 ± 0.02 mM⁻¹·s⁻¹ . Similar kinetic characterizations would be valuable for ATP synthase components.

What approaches can be used to study the assembly process of ATP synthase in Methylobacterium populi?

Understanding the assembly pathway of ATP synthase complexes provides insights into bacterial physiology and potential targets for intervention. Several complementary approaches can elucidate this process:

  • In vivo Assembly Studies:

    • Pulse-chase experiments with isotopically labeled amino acids

    • Co-immunoprecipitation of assembly intermediates

    • Fluorescent protein tagging of key subunits

  • In vitro Reconstitution:

    • Sequential addition of purified subunits

    • Monitoring assembly using analytical ultracentrifugation

    • Functional testing of partially assembled complexes

  • Genetic Approaches:

    • Knockout/knockdown of assembly factors

    • Expression of dominant-negative subunit variants

    • Complementation studies in assembly-deficient strains

The assembly of bacterial ATP synthases typically follows an ordered pathway, with membrane insertion of F₀ components preceding the attachment of F₁ subunits. The b/b' subunits play a crucial role in this process, serving as an assembly platform that helps coordinate the incorporation of other subunits into the functional complex.

What are the critical controls required when studying recombinant Methylobacterium populi ATP synthase subunits?

Rigorous experimental design for recombinant ATP synthase studies must include appropriate controls to ensure reliable and interpretable results:

Table 3: Essential Controls for ATP Synthase Experiments

Experiment TypePositive ControlsNegative ControlsInternal Controls
Expression studiesKnown expressible proteinEmpty vectorHousekeeping gene expression
Protein-protein interactionKnown interaction partnersNon-interacting proteinsConcentration controls
Activity assaysPurified F₁F₀ complexHeat-denatured enzymeATPase inhibitor controls
Structural studiesPreviously characterized homologDenatured proteinResolution standards

For functional studies, it is essential to compare the activity of recombinant subunits with that of the native complex. Additionally, comparison with well-characterized ATP synthases from model organisms like E. coli or Bacillus PS3 provides valuable context for interpreting results .

When investigating the b/b' subunit specifically, controls should include isolated subunits, partially assembled complexes, and intact ATP synthase to distinguish subunit-specific effects from those related to the entire complex.

How can researchers overcome protein solubility challenges when working with ATP synthase membrane components?

The hydrophobic nature of the b/b' subunit presents significant challenges for expression and purification. Several strategies can enhance solubility:

  • Fusion Tag Selection:

    • MBP tags significantly enhance solubility while maintaining native folding

    • SUMO fusion can improve expression and solubility of difficult proteins

    • Thioredoxin (trxA) fusions facilitate disulfide bond formation when needed

  • Expression Conditions:

    • Lower temperature (16-20°C) expression reduces inclusion body formation

    • Co-expression with chaperones (GroEL/GroES, DnaK) improves folding

    • Osmolyte addition to culture media can enhance protein stability

  • Buffer Optimization:

    • Detergent screening to identify optimal solubilization conditions

    • Addition of glycerol (5-10%) to stabilize protein structure

    • Use of amphipols or nanodiscs for membrane protein stabilization

  • Protein Engineering:

    • Truncation constructs to remove highly hydrophobic regions

    • Surface residue substitutions to enhance solubility

    • Disulfide engineering to stabilize tertiary structure

Successful expression systems for recombinant ATP synthase components include E. coli BL21(DE3), although alternative strains like Rosetta-GAMI may provide advantages for proteins with rare codons or multiple disulfide bonds .

How should researchers analyze evolutionary conservation patterns in ATP synthase subunits across Methylobacterium species?

Evolutionary analysis of ATP synthase components across the Methylobacterium genus can reveal functionally important regions and species-specific adaptations:

  • Multiple Sequence Alignment:

    • Align atpG sequences from all available Methylobacterium genomes

    • Include outgroups from related genera for evolutionary context

    • Use specialized tools for transmembrane protein alignment

  • Conservation Scoring:

    • Calculate per-residue conservation scores

    • Identify highly conserved motifs across all Methylobacterium groups

    • Map conservation onto structural models when available

  • Phylogenetic Analysis:

    • Construct maximum likelihood trees of atpG sequences

    • Compare with species trees to identify potential horizontal gene transfer

    • Analyze selection pressures using dN/dS ratios

The four evolutionarily distinct groups of Methylobacterium (A, B, C, and D) identified through comprehensive phylogenomic analysis provide a framework for understanding ATP synthase evolution . Comparison of ATP synthase components across these groups may reveal adaptations related to their different environmental niches, from plant phyllosphere to soil and water sediments .

What are the key considerations when interpreting structural data from recombinant versus native ATP synthase complexes?

When comparing structural data between recombinant and native ATP synthase complexes, researchers should consider several factors that might impact interpretation:

  • Expression Artifacts:

    • Fusion tags may alter protein conformation or interactions

    • Expression host lipid composition differs from native environment

    • Overexpression may force non-native oligomeric states

  • Purification Effects:

    • Detergent solubilization can distort membrane protein structure

    • Removal from native lipid environment may alter conformation

    • Loss of loosely associated factors during purification

  • Structural Technique Limitations:

    • Cryo-EM preparation may select for specific conformational states

    • Crystal packing forces in X-ray crystallography can distort structure

    • Resolution limitations may obscure important details

  • Functional Validation:

    • Structural insights should be validated with functional assays

    • Mutagenesis of identified structural features can confirm importance

    • Native mass spectrometry can verify subunit stoichiometry

The successful structural characterization of bacterial ATP synthases like that from Bacillus PS3 provides a valuable template for interpreting Methylobacterium populi data . Researchers should carefully consider how structural insights from one bacterial species translate to another, particularly when ecological niches differ substantially.

What emerging technologies hold promise for advancing our understanding of Methylobacterium populi ATP synthase?

Several cutting-edge technologies show particular promise for deepening our understanding of bacterial ATP synthases:

  • Time-resolved Cryo-EM: Capturing short-lived conformational states during the rotary catalytic cycle

  • Single-molecule FRET: Monitoring real-time conformational changes during ATP synthesis/hydrolysis

  • In-cell NMR: Observing ATP synthase structure and dynamics in native cellular environments

  • AlphaFold2 and related AI approaches: Predicting species-specific structural features and interactions

  • Microfluidics-based assays: Measuring ATP synthase activity under precisely controlled conditions

These emerging technologies, combined with traditional biochemical and structural approaches, will enable researchers to develop more comprehensive models of how bacterial ATP synthases, including that of Methylobacterium populi, function at the molecular level.

How can understanding Methylobacterium populi ATP synthase contribute to broader research on bacterial bioenergetics?

Research on Methylobacterium populi ATP synthase contributes to our broader understanding of bacterial bioenergetics in several ways:

  • Evolutionary Adaptations: As Methylobacterium occupies diverse ecological niches, its ATP synthase may reveal adaptations to specific environmental conditions, providing insights into bioenergetic flexibility.

  • Metabolic Integration: The association of many Methylobacterium species with plants suggests potential adaptations in energy metabolism related to plant-microbe interactions and methylotrophic lifestyle.

  • Structural Diversity: Understanding the structural variations in ATP synthases across the four distinct Methylobacterium groups (A-D) can illuminate how evolutionary pressures shape bioenergetic machinery.

  • Functional Conservation: Identifying conserved mechanisms across distantly related bacterial ATP synthases helps define the core principles of biological energy conversion.

The diverse metabolic capabilities of Methylobacterium populi, including its ability to degrade various xenobiotic compounds , suggest that its energy generation systems, including ATP synthase, may have unique adaptations worth investigating for both fundamental science and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.