Recombinant Methylobacterium populi Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Methylobacterium populi Glycerol-3-phosphate acyltransferase (plsY) is a bacterial enzyme critical for the initiation of phosphatidic acid biosynthesis, a precursor to membrane phospholipids. It catalyzes the transfer of acyl groups from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA) . This reaction is part of the canonical bacterial lipid biosynthesis pathway involving PlsX and PlsY, where PlsX generates acyl-phosphate intermediates .

Key Properties

PropertyDetail
UniProt IDB1ZLL2
EC Number2.3.1.n3
Protein Length202 amino acids
Active Site MotifsMotif 1 (Ser, Arg), Motif 2 (phosphate-binding loop), Motif 3 (His, Asn, Glu)
Subcellular LocalizationIntegral membrane protein with five transmembrane segments

Membrane Topology

PlsY has five transmembrane domains, with the N-terminus and two short loops exposed externally . Mutagenesis studies in Streptococcus pneumoniae PlsY revealed:

  1. Motif 1: Essential serine (Ser) and arginine (Arg) residues for catalysis.

  2. Motif 2: Conserved glycines critical for glycerol-3-phosphate binding (K<sub>m</sub> defects observed with mutations) .

  3. Motif 3: His and Asn residues for activity; Glu for structural integrity .

Functional Partners

PlsY interacts with enzymes involved in lipid metabolism and glycerol processing:

PartnerFunctionInteraction Score
plsXConverts acyl-ACP to acyl-phosphate0.985
gpsAGlycerol-3-phosphate dehydrogenase (NAD-dependent)0.947
glpKGlycerol kinase (phosphorylates glycerol to glycerol-3-phosphate)0.922
Mpop_1538Phospholipid/glycerol acyltransferase0.936

Data sourced from STRING interaction network analysis .

Enzyme Specificity

  • Substrate Preference: Utilizes acyl-phosphate (not acyl-CoA or acyl-ACP) .

  • Inhibition: Noncompetitively inhibited by palmitoyl-CoA .

  • Catalytic Efficiency: Recombinant PlsY exhibits specific activity of 0.1 ± 0.02 U mg<sup>−1</sup> for glycerol-3-phosphate .

Biotechnological Relevance

  • Industrial Production: Recombinant plsY is used in studies of bacterial lipid synthesis and membrane engineering .

  • Ecological Context: Methylobacterium populi strains like YC-XJ1 and VP2 degrade xenobiotics (e.g., herbicides, PAEs) and promote plant growth, suggesting potential for bioremediation .

Amino Acid Sequence

The N-terminal region of plsY (1–202 aa) includes conserved motifs critical for catalysis:

RegionSequence Segment
Motif 1MTPLLAAGWPALIAALVLGYACGAIPFGLILTKVAGLGDVRTIGSGNIGATNVLRTGRKG...
Motif 2LAAATLLCDALKGTLPVLAAGQWGEGPALAAGLGAFLGHLFPVWLGFKGGKGVATFIGVL...
Motif 3...LALSPLTLAAFAAIWLGLAFALKYSSLAALAASAATPVILWALGHGGVAALFLVLAALLW

Full sequence available in UniProt entry B1ZLL2 .

Comparative Analysis with Homologs

OrganismKey Differences
Streptococcus pneumoniaeMembrane topology identical; motifs conserved but substrate affinities vary .
Mycobacterium tuberculosisRv3816c (AGPAT) shares motif 3 residues (His, Asn, Glu) but uses acyl-CoA .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please include them in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Important: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your specific needs.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
plsY; Mpop_3514; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Target Names
plsY
Target Protein Sequence
MTPLLAAGWPALIAALVLGYACGAIPFGLILTKVAGLGDVRTIGSGNIGATNVLRTGRKG LAAATLLCDALKGTLPVLAAGQWGEGPALAAGLGAFLGHLFPVWLGFKGGKGVATFIGVL LALSPLTLAAFAAIWLGLAFALKYSSLAALAASAATPVILWALGHGGVAALFLVLAALLW WKHAPNIRRLAAGTEGRIGQKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). Notably, this enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of glycerol-3-phosphate acyltransferase (PlsY) in bacterial membrane phospholipid biosynthesis?

PlsY plays a critical role in bacterial membrane phospholipid biosynthesis by catalyzing the transfer of an acyl group from acylphosphate to glycerol-3-phosphate. This reaction represents a key step in the initiation of phosphatidic acid formation, which is a precursor for membrane phospholipids. The pathway typically begins with the conversion of acyl-acyl carrier protein to acylphosphate by PlsX, followed by the PlsY-catalyzed transfer of the acyl group to glycerol-3-phosphate. This two-step process constitutes the most widely distributed biosynthetic pathway for initiating phospholipid synthesis in bacterial membranes .

What structural features characterize bacterial PlsY enzymes?

Based on studies of Streptococcus pneumoniae PlsY, these enzymes typically possess five membrane-spanning segments with the amino terminus and two short loops positioned on the external face of the membrane. The enzyme contains three larger cytoplasmic domains, each containing a highly conserved sequence motif critical for catalytic function. Specifically:

  • Motif 1: Contains essential serine and arginine residues critical for catalysis

  • Motif 2: Features characteristics of a phosphate-binding loop involved in glycerol-3-phosphate binding

  • Motif 3: Contains conserved histidine and asparagine residues important for activity, plus a glutamate residue critical for structural integrity

Each of these conserved domains plays a specific role in the enzyme's function, with site-directed mutagenesis confirming their importance to PlsY catalysis.

How do researchers differentiate between PlsY activity and other acyltransferases?

Researchers can differentiate PlsY activity from other acyltransferases through several methodological approaches:

  • Substrate specificity analysis: PlsY specifically uses acylphosphate as the acyl donor, rather than acyl-CoA or acyl-ACP directly used by other acyltransferases.

  • Inhibition studies: PlsY from bacterial sources is noncompetitively inhibited by palmitoyl-CoA, providing a distinctive regulatory profile compared to other acyltransferases .

  • Biochemical assays: Activity assays measuring the transfer of acyl groups from acylphosphate to glycerol-3-phosphate can specifically detect PlsY activity.

  • Molecular identification: PCR amplification using primers targeting the conserved motifs unique to PlsY can identify the presence of this enzyme at the genetic level.

What methodologies are recommended for expressing and purifying recombinant PlsY from Methylobacterium populi?

For successful expression and purification of recombinant Methylobacterium populi PlsY, consider the following methodological approach:

  • Expression system selection:

    • Heterologous expression in E. coli using vectors with inducible promoters

    • Expression in native or closely related Methylobacterium hosts

    • Cell-free expression systems for challenging membrane proteins

  • Expression optimization strategy:

    • Include affinity tags (His6, FLAG) for purification

    • Optimize codon usage for the expression host

    • Express at lower temperatures (16-25°C) to improve proper folding

    • Supplement media with glycerol-3-phosphate or lipid precursors

  • Purification protocol:

    • Membrane fraction isolation through ultracentrifugation

    • Solubilization with mild detergents (DDM, CHAPS, or Triton X-100)

    • Affinity chromatography using engineered tags

    • Size-exclusion chromatography for final purification

  • Activity verification:

    • Enzymatic assays measuring acyl transfer to glycerol-3-phosphate

    • Kinetic parameter determination (kcat/Km values in the range of 0.8-1.8 mM−1·s−1, based on other recombinant enzymes from Methylobacterium populi)

For recombinant enzymes from Methylobacterium populi, researchers have reported specific activities around 0.1 ± 0.02 U mg−1, which provides a reference for expected PlsY activity levels .

What analytical techniques can determine the membrane topology of PlsY in Methylobacterium populi?

Multiple complementary approaches can determine membrane topology:

  • Substituted Cysteine Accessibility Method (SCAM):

    • This technique was successfully used for Streptococcus pneumoniae PlsY

    • Involves systematic replacement of residues with cysteines

    • Treatment with membrane-impermeable sulfhydryl reagents

    • Analysis of accessibility pattern reveals transmembrane arrangement

  • Fusion protein approach:

    • Create PlsY fusions with reporter proteins (GFP, alkaline phosphatase)

    • Expression and localization analysis in membrane fractions

    • Fluorescence microscopy to confirm membrane integration

  • Protease protection assays:

    • Treatment of membrane preparations with proteases

    • Identification of protected fragments by Western blotting

    • Mass spectrometry to determine cleavage sites

  • Computational prediction validation:

    • Initial prediction using topology algorithms

    • Experimental validation of key features

    • Integration of multiple methods for consensus model

These approaches can determine the five-transmembrane topology characteristic of PlsY enzymes and identify cytoplasmic domains containing catalytic motifs.

How should researchers design site-directed mutagenesis experiments to investigate PlsY active sites?

For effective site-directed mutagenesis studies of PlsY active sites:

  • Target selection strategy:

    • Focus on the three conserved motifs identified in PlsY enzymes

    • Prioritize the serine and arginine residues in Motif 1

    • Target the glycines in the phosphate-binding loop of Motif 2

    • Investigate the histidine, asparagine, and glutamate in Motif 3

  • Mutation design:

    • Conservative substitutions to probe specific roles (e.g., S→T, R→K)

    • Alanine scanning of conserved regions

    • Charge reversal mutations to test electrostatic interactions

  • Functional analysis protocol:

    • Enzymatic activity assays comparing wild-type and mutant proteins

    • Determination of kinetic parameters (Km, kcat)

    • Thermal stability assessments

    • Substrate binding studies

  • Data interpretation framework:

    • Distinguish between effects on substrate binding versus catalysis

    • Correlate with structural predictions or models

    • Compare with mutations in homologous enzymes

Previous studies with Streptococcus pneumoniae PlsY demonstrated that mutations of conserved glycines in Motif 2 to alanines resulted in increased Km values for glycerol-3-phosphate, confirming this motif's role in substrate binding .

How does DNA methylation influence the expression and regulation of acyltransferases like PlsY?

DNA methylation can significantly impact acyltransferase expression through several mechanisms:

  • Epigenetic regulation analysis:

    • Bisulfite sequencing to identify methylated CpG sites in promoter regions

    • Methylation-sensitive restriction enzyme digestion (e.g., HpaII) followed by quantitative PCR

    • Chromatin immunoprecipitation (ChIP) to assess transcription factor binding

  • Functional impact assessment:

    • Reporter assays comparing methylated versus unmethylated promoter constructs

    • Analysis of transcription factor binding to methylated and unmethylated DNA

    • Correlation of methylation status with gene expression levels

  • DNA methyltransferase interactions:

    • ChIP assays to detect binding of DNA methyltransferases (Dnmt1, Dnmt3a, Dnmt3b)

    • Analysis of histone modifications associated with DNA methylation status

    • Effects of methyltransferase overexpression or inhibition

Studies of glycerol-3-phosphate acyltransferase 1 (GPAT1) have shown that DNA methylation of the promoter prevents SREBP-1c-induced transcriptional activity. In vitro reporter assays demonstrated that methylation of the GPAT promoter eliminated the increase in reporter activity normally observed with SREBP-1c expression, revealing how epigenetic mechanisms can regulate acyltransferase expression .

What experimental evolution approaches can elucidate PlsY function and adaptation in Methylobacterium?

Experimental evolution provides powerful tools for studying enzyme adaptation:

  • Experimental design parameters:

    • Multiple replicate populations (typically 8 or more)

    • Single-colony isolation to initiate each population

    • Defined transfer volumes (e.g., 150 μl) and intervals (every 2 days)

    • Standardized growth conditions (30°C, defined medium)

  • Selection pressure strategies:

    • Growth under conditions requiring altered membrane lipid composition

    • Serial passage with increasing concentrations of PlsY inhibitors

    • Carbon source switches affecting lipid metabolism pathways

    • Temperature fluctuations requiring membrane adaptation

  • Analysis approaches:

    • Whole-genome sequencing to identify adaptive mutations

    • Competitive fitness assays against ancestral strains using fluorescent markers

    • Enzyme activity measurements before and after evolution

    • Membrane lipid composition analysis

  • Data interpretation framework:

    • Identification of parallel mutations across replicate populations

    • Reconstruction of mutations in ancestral backgrounds

    • Integration of phenotypic and genotypic data

Previous experimental evolution studies with Methylobacterium have successfully used these approaches over 1500 generations, with fitness assayed using fluorescent proteins (Venus or mCherry) expressed from chromosomal loci .

What are the optimal conditions for assaying PlsY activity in vitro?

For optimal PlsY activity assays:

  • Reaction component preparation:

    • Acylphosphate substrate preparation or synthesis

    • Glycerol-3-phosphate buffered solutions

    • Appropriate detergent selection for enzyme solubilization

    • Divalent cation supplementation (Mg2+ or Mn2+)

  • Assay condition optimization:

    • Buffer composition: Typically HEPES or Tris at pH 7.0-8.0

    • Temperature: Usually 30-37°C for Methylobacterium enzymes

    • Detergent concentration: Critical for maintaining enzyme activity while preventing aggregation

    • Substrate concentration ranges: Based on expected Km values

  • Detection methodology:

    • Radiochemical assays using 14C or 3H-labeled substrates

    • HPLC or LC-MS for product identification and quantification

    • Spectrophotometric coupled assays for continuous monitoring

    • Fluorescence-based methods for high-throughput screening

  • Data analysis protocol:

    • Determination of kinetic parameters (Km, Vmax, kcat)

    • Inhibition studies to characterize regulatory mechanisms

    • Substrate specificity profiling

ParameterTypical Range for Methylobacterium EnzymesMeasurement Method
Specific Activity0.1 ± 0.02 U mg−1Standard activity assay
kcat/Km0.8-1.8 mM−1·s−1Steady-state kinetics
pH Optimum7.0-8.0Activity vs. pH profile
Temperature Optimum30°CActivity vs. temperature profile

These parameters provide a starting point for optimizing PlsY activity assays based on data from other recombinant enzymes from Methylobacterium populi .

How can researchers overcome challenges in structural studies of membrane-bound PlsY?

Structural studies of membrane proteins like PlsY present several challenges requiring specialized approaches:

These approaches need to be optimized specifically for Methylobacterium populi PlsY, considering its five-transmembrane topology and three cytoplasmic domains containing conserved catalytic motifs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.