Recombinant Methylobacterium populi Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Methylobacterium populi

Methylobacterium populi is a bacterium known for its ability to degrade various compounds and its potential use in bioremediation . Methylobacterium , including M. populi, are pink-pigmented facultative methylotrophic (PPFM) bacteria capable of synthesizing carotenoids and growing on one-carbon compounds . M. populi YC-XJ1, a specific strain, was isolated from desert soil and demonstrates a diverse capacity to degrade aromatic oxyphenoxypropionic acid esters (AOPPs) herbicide, phthalate esters (PAEs), organophosphorus flame retardants (OPFRs), chlorpyrifos, and phoxim . Its genome contains numerous degradation pathways and hydrolase resources, making it a candidate for bioremediation of polluted sites .

Large-Conductance Mechanosensitive Channel (MscL)

MscL, or Large-conductance mechanosensitive channel, is a protein found in bacteria like Methylobacterium populi . These channels respond to mechanical forces, such as changes in membrane tension, opening a pore that allows ions and small molecules to pass through the cell membrane .

Recombinant MscL

Recombinant MscL refers to MscL that is produced using recombinant DNA technology. This involves introducing the gene encoding MscL into a host organism (e.g., E. coli), which then produces the protein . The recombinant protein can then be isolated and used for research purposes .

Gene and Protein Information

  • Gene Name: mscL

  • Ordered Locus Names: Mpop_2607

  • Protein Names: Large-conductance mechanosensitive channel

  • Uniprot NO.: B1ZC68

  • AA Sequence: MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAITGGLDFSNYYIPLS
    SKVQAGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNGLKSKEEAKPKPEA
    EVPADVKLLAEIRDLLAARREA

  • Expression Region: 1-142

Potential Applications

Although the primary research focus is not directly on the MscL of Methylobacterium populi, the broader context of Methylobacterium species suggests potential applications:

  • Bioremediation: Methylobacterium spp., including M. populi, can degrade toxic compounds such as TNT, RDX, HMX, and dichloromethane, making them useful in cleaning up contaminated environments .

  • Plant Growth Promotion: Methylobacterium species can produce hormones like cytokinins and auxins, which promote plant growth. They can also induce systemic resistance in plants against pathogens .

  • Biocontrol: Some Methylobacterium strains have demonstrated biocontrol potential against fungal pathogens .

Methylobacterium populi Genome Analysis

Genome analysis of Methylobacterium populi YC-XJ1 shows a high number of genes related to metabolism . The most abundant COG types include energy production and conversion, amino acid transport and metabolism, inorganic ion transport and metabolism, and carbohydrate transport and metabolism . GO term analysis indicates that genes are primarily involved in catalytic activity, binding, metabolic processes, and cellular processes .

Relevant Data

CategoryDescription
ANI AnalysisMethylobacterium populi YC-XJ1 is closely related to Methylobacterium populi BJ001, with 97.9% identity and 88.6% genome coverage .
COG Categories4170 sequences annotated to 4 COG categories and 21 COG types; 1342 genes (32.2%) annotated to metabolism. Top COG types include energy production and conversion (270 genes, 6.5%), amino acid transport and metabolism (265 genes, 6.4%), inorganic ion transport and metabolism (248 genes, 5.9%), and carbohydrate transport and metabolism (175 genes, 4.2%) .
GO Terms (Molecular Function)2733 genes categorized; most involved in catalytic activity (GO:0003824, 2023 genes, 48.0%) and binding (GO:0005488, 1385 genes, 32.9%) .
GO Terms (Biological Process)2473 genes categorized; a large proportion involved in metabolic process (GO:0008152, 1910 genes, 27.0%), cellular process (GO:0009987, 1558 genes, 22.0%), and single-organism process (GO:0044699, 1354 genes, 19.1%) .
GO Terms (Cellular Component)1674 genes categorized; most involved in functions of membrane (GO:0016020, 1092 genes, 26.2%), membrane part (GO:0044425, 992 genes, 23.8%), cell (GO:0005623, 890 genes, 21.4%), and cell part (GO:0044464, 870 genes, 20.9%) .
Degradation ActivityMethylobacterium populi YC-XJ1 can degrade aromatic oxyphenoxypropionic acid esters (AOPPs), phthalate esters (PAEs), organophosphorus flame retardants (OPFRs), chlorpyrifos, and phoxim . Recombinant QPEH2 showed a specific activity of 0.1 ± 0.02 U mg−1 for QPE with kcat/Km values of 1.8 ± 0.016 (mM−1·s−1). Recombinant DEPH1 showed a specific activity of 0.1 ± 0.02 U mg−1 for DEP with kcat/Km values of 0.8 ± 0.02 (mM−1·s−1) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
mscL; Mpop_2607; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Target Names
mscL
Target Protein Sequence
MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAITGGLDFSNYYIPLS SKVQAGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNGLKSKEEAKPKPEA EVPADVKLLAEIRDLLAARREA
Uniprot No.

Target Background

Function

This protein is a large-conductance mechanosensitive channel (MscL) from Methylobacterium populi. It functions as a membrane channel that opens in response to membrane stretch, potentially playing a role in regulating cellular osmotic pressure.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do temperature conditions affect cultivation of Methylobacterium populi for MscL studies?

Temperature selection during isolation and cultivation of Methylobacterium species, including M. populi, critically impacts which lineages are recovered. Research has demonstrated that isolation at different temperatures (20°C versus 30°C) results in the recovery of markedly different subsets of Methylobacterium lineages . This suggests long-term adaptation to temperature within the genus.

While historical approaches have typically cultured Methylobacterium assuming optimal growth in the range of 25-30°C, studies in temperate forests where temperatures typically range from 10-20°C during growing seasons have revealed previously underestimated diversity by employing dual-temperature isolation strategies . For M. populi MscL studies, researchers should consider employing both standard (30°C) and lower temperature (20°C) cultivation to ensure representation of potentially temperature-adapted variants of the channel.

What experimental techniques are most effective for studying MscL channel function in Methylobacterium?

Several experimental approaches have proven valuable for studying MscL channels in bacterial systems:

  • Patch Clamp Electrophysiology: This technique was foundational in the discovery and characterization of MscL channels. By applying suction through electrodes to generate negative pressure and membrane tension, channel opening can be directly observed and measured. MscL shows large conductance (3.6 nS), approximately 1-2 orders of magnitude larger than most eukaryotic channels .

  • Enrichment and Reconstitution: MscL activity survives solubilization with detergent, enrichment over size exclusion columns, and reconstitution into purified lipids. This enables study of the isolated channel in controlled lipid environments .

  • Genetic Approaches: Cloning the mscL gene, creating knockout strains, and expressing the channel in trans or in heterologous systems provides powerful confirmation of gene identity and function. Single-residue substitutions that alter gating properties can further validate channel identity and probe structure-function relationships .

  • Spectroscopic Methods: Transmission Fourier transform infrared spectroscopy and circular dichroism spectra have been used to confirm that MscL proteins are highly helical in both detergents and liposomes .

How does membrane lipid composition affect recombinant Methylobacterium populi MscL function?

Membrane lipid composition plays a critical role in MscL channel function across bacterial species. Studies have demonstrated that MscL senses and responds to lateral pressure profiles within the lipid membrane, aligning with the force-from-lipid (FFL) hypothesis of mechanosensation . While specific lipid requirements for M. populi MscL have not been extensively characterized in the available literature, research on MscL homologs provides important insights:

  • For Escherichia coli MscL, no specific lipid headgroup is essential for channel activity. The channel functions even in phosphatidylcholine lipids, which are not synthesized by E. coli .

  • In contrast, Mycobacterium tuberculosis MscL requires phosphatidylinositol for normal function .

This variation suggests that recombinant M. populi MscL may have specific lipid requirements for optimal function. Researchers working with recombinant M. populi MscL should systematically test different lipid compositions when reconstituting the channel in artificial membranes. The following table summarizes potential lipid considerations:

Lipid TypeKnown Effect on MscL HomologsConsideration for M. populi MscL
PhosphatidylcholineSupports E. coli MscL function despite not being nativeMay be suitable for initial reconstitution studies
PhosphatidylinositolRequired for M. tuberculosis MscL functionShould be tested in reconstitution experiments
AmphipathsCan activate bacterial MS channelsMay be useful tools for functional assays
Lipid-like moleculesCan add stresses in the membrane to modulate channel activityPotential modulators for experimental manipulation

What structural features of MscL channels are likely conserved in Methylobacterium populi, and what are the implications for recombinant expression?

Based on studies of MscL channels across bacterial species, several structural and functional themes are likely conserved in M. populi MscL:

  • Transmembrane Topology: MscL is predicted to possess two helical transmembrane domains (TM1 and TM2) .

  • Critical Functional Elements: Key features likely include:

    • The ability to directly sense and respond to biophysical changes in the membrane

    • An α helix ("slide helix") or series of charges ("knot in a rope") at the cytoplasmic membrane boundary to guide transmembrane movements

    • Important subunit interfaces that, when disrupted, cause inappropriate channel gating

  • Consensus Motif: Many channel families, including MscL, share a consensus motif N-h-h-D, where "h" letters are hydrophobic amino acids. This motif plays important functional roles in MscL and may be conserved in M. populi .

For recombinant expression, these conserved features have several implications:

  • Expression systems must support proper membrane insertion and folding of transmembrane helices

  • The native lipid environment may need to be mimicked for optimal channel function

  • Purification strategies should preserve the integrity of subunit interfaces

  • The presence of the consensus motif could be used as a quality control check for proper expression and folding

How can site-directed mutagenesis be used to investigate the gating mechanism of recombinant M. populi MscL?

Site-directed mutagenesis represents a powerful approach for investigating MscL gating mechanisms. Studies have demonstrated that single-residue substitutions can dramatically alter the gating properties of MscL channels . For M. populi MscL research, a systematic mutagenesis approach would include:

  • Targeting Conserved Motifs: The N-h-h-D consensus motif has been shown to play important functional roles in many channels including MscL. Mutations in this region could provide insights into conserved gating mechanisms .

  • Membrane Interface Residues: Mutations in the "slide helix" or the series of charges at the cytoplasmic membrane boundary could reveal how these elements guide transmembrane movements during gating .

  • Subunit Interfaces: Targeted mutations at subunit interfaces may help understand how disruptions can cause inappropriate channel gating .

  • Lipid-Sensing Regions: Mutations in regions involved in sensing membrane tension could elucidate the molecular basis of mechanosensation in M. populi MscL.

A methodical approach would involve:

  • Creating single-residue substitutions using PCR-based mutagenesis

  • Expressing mutant channels in MscL-deficient bacteria

  • Assessing channel function using patch clamp electrophysiology

  • Comparing gating thresholds, open probabilities, and conductance properties

  • Correlating functional changes with structural predictions

What are the unique challenges in expressing recombinant M. populi MscL in heterologous systems?

Expressing functional recombinant M. populi MscL presents several challenges that researchers should address:

  • Temperature Adaptation Considerations: Given that Methylobacterium lineages show temperature-dependent growth characteristics , expression systems must be optimized for temperature. Standard E. coli expression at 37°C may not yield properly folded M. populi proteins if they are adapted to lower temperatures (20°C).

  • Membrane Compatibility: MscL channels directly sense membrane properties, so heterologous expression systems must provide a compatible membrane environment. The membrane composition of the expression host may not match the native environment of M. populi MscL .

  • Proper Channel Assembly: MscL functions as a multimeric complex. Ensuring proper assembly of the channel complex in heterologous systems is critical for obtaining functional channels .

  • Potential Toxicity: Inappropriate gating of overexpressed MscL could lead to cellular stress or toxicity in expression hosts, potentially selecting for inactive mutants during cultivation.

Successful strategies may include:

  • Using low-temperature induction protocols

  • Employing lipid supplementation during expression

  • Testing multiple expression hosts with different membrane compositions

  • Utilizing inducible promoters with tight regulation to control expression levels

How does environmental adaptation in Methylobacterium species potentially impact MscL structure and function?

Methylobacterium species show remarkable environmental adaptations that may influence MscL structure and function:

  • Temperature Adaptation: Methylobacterium lineages demonstrate temperature-dependent growth strategies, with distinct lineages preferentially growing at either 20°C or 30°C . This suggests that membrane properties and potentially MscL function may be optimized for specific temperature ranges.

  • Spatial and Temporal Dynamics: Methylobacterium diversity shows heterogeneous distribution even at very local space and time scales . This environmental responsiveness may be reflected in adaptations of membrane proteins, including MscL.

  • Seasonal Variation: Research has documented "a progressive replacement of lineages with a high-yield growth strategy typical of cooperative, structured communities" across seasons. This phenotypic plasticity may correlate with changes in membrane composition and, consequently, MscL function.

These adaptations suggest that M. populi MscL may have evolved specific structural or functional characteristics suited to its ecological niche. When studying recombinant M. populi MscL, researchers should consider how environmental factors might influence channel behavior and design experiments to assess these potential adaptations.

What potential applications exist for recombinant M. populi MscL in biotechnology and medicine?

Recombinant M. populi MscL has several promising potential applications:

  • Triggered Nanovalves: Research has demonstrated that the modality of MscL channels can be changed, suggesting their use as triggered nanovalves in nanodevices, including those for drug targeting .

  • Antibiotic Development: Studies have shown that the antibiotic streptomycin opens MscL and uses it as one of the primary paths to the cytoplasm. The identification of novel specific agonist compounds demonstrates that the channel is a valid drug target .

  • Biosensors: The mechanosensitive properties of MscL could potentially be harnessed to create biosensors for detecting mechanical forces or membrane perturbations.

  • Drug Delivery Systems: MscL could potentially serve as a controlled release mechanism in liposomal drug delivery systems, where specific triggers could open the channel to release encapsulated compounds.

  • Medical Imaging: MscL channels have potential applications in enhanced or "smart" magnetic resonance imaging contrast .

How can comparative genomics approaches inform our understanding of M. populi MscL?

Comparative genomics represents a powerful approach for investigating M. populi MscL:

  • Phylogenetic Analysis: Deep, culture-independent barcoded marker gene sequencing coupled with culture-based approaches has revealed previously underestimated diversity in Methylobacterium . Similar approaches focused on mscL sequences could reveal evolutionary relationships and potential functional variations.

  • Environmental Correlation: Analysis of mscL sequence variations across Methylobacterium species from different environmental niches could reveal adaptive patterns. Research has shown that Methylobacterium diversity is structured by temperature, geography, seasonality, and host tree species .

  • Structure-Function Predictions: Comparing mscL sequences across bacterial species with known functional differences could help predict structural elements responsible for specific functional properties in M. populi MscL.

  • Novel Regulatory Mechanisms: Comparative analysis of genomic contexts surrounding mscL genes might reveal unique regulatory mechanisms in M. populi that could inform expression strategies.

Methodologically, researchers should:

  • Extract genomic data from multiple Methylobacterium strains

  • Identify and align mscL sequences

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Correlate sequence variations with environmental or functional data

  • Apply computational modeling to predict structural and functional implications of sequence differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.