Recombinant Methylobacterium populi Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC Insertase

YidC is a universally conserved membrane protein insertase critical for the co-translational integration, folding, and assembly of membrane proteins across bacteria, mitochondria, and chloroplasts . In bacteria, YidC operates independently or alongside the Sec translocon, facilitating substrate insertion at the membrane-lipid interface through a conserved hydrophilic cavity . Methylobacterium populi, a Gram-negative bacterium known for xenobiotic biodegradation and plant growth promotion , encodes its own YidC homolog, which has been recombinantly produced for structural and functional studies .

Mechanistic Role in Membrane Protein Biogenesis

YidC mediates substrate insertion via a hydrophobic slide formed by transmembrane segments (e.g., TM3 and TM5) . Structural models reveal a hydrophilic cavity accessible from the cytoplasm and lipid phase, enabling substrate interaction at the membrane interface . Mutations in these regions disrupt substrate insertion efficiency .

Substrate Specificity and Cooperativity

  • Sec-Independent Insertion: YidC autonomously integrates single-spanning proteins (e.g., Pf3 coat protein) .

  • Sec-YEG Collaboration: Assists in the biogenesis of multi-pass membrane proteins (e.g., F0c subunit of ATP synthase) .

  • Partner Proteins: Interaction with YibN enhances the insertion of YidC-dependent substrates like SecG and F0c .

Biophysical Studies

Recombinant YidC enables in vitro assays to study:

  • Membrane protein insertion kinetics .

  • Lipid-protein interactions via molecular dynamics simulations .

  • Conformational changes during substrate binding .

Comparative Analysis of YidC Homologs

FeatureM. populi YidCE. coli YidCMitochondrial Oxa1
Transmembrane Domains5 conserved TMs5 TMs5 TMs
Substrate RangeSec-independent/cooperativeSec-independent/cooperativeOxidative phosphorylation complexes
Structural MotifsHydrophilic cavityAmphiphilic grooveHydrophobic slide
Functional PartnersYibN SecYEG Mba1/MTCH2

Challenges and Future Directions

  • Structural Resolution: High-resolution cryo-EM or crystallography studies are needed to elucidate substrate-binding mechanisms.

  • Ecological Relevance: Link YidC’s role in M. populi to its bioremediation and plant growth-promoting traits .

  • Biotechnological Applications: Engineer YidC for synthetic membrane protein production or industrial biocatalysis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Mpop_2308; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Target Names
yidC
Target Protein Sequence
MGNDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAVQSQTAQNTAPQSADGIPSPSPR EGSPNAPVPGTVPGAAAQGPISREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYH ETVSDESPRIVLLSPAGSANPYYAEFGWVGANAGPLPNGDTLWKADGDLLAPGKPLTLTW DNGQGLLFKRIVAVDDKFMFTVRDEVENSSANPVTLYPYSLVSRWGKPQTQGYYVLHEGL IGVLGSDGLQEYTYDKVGKEPAYGGAATQGKAWSNVTGGWVGITDKYWAAAAIPDQDKPF TGAFTERTDGATKIYQTSVRGDAVTVAPSASSATTQRLFAGAKEVNQINAYERDLGIKQF DLMIDWGWFWFLTKPMFRALDFFYHLLGNFGVSILLVTLILKIFFLPIANRSYVSMAKMK AVQPEMTSIRERYKDDRTKQQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITI EMRHAPFFGWIHDLAAPDPTSIMNLFGLLPFAAPDFIHLGVWPIIMGITMFIQMKMNPAP PDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYIIMRRNGVKVELWDNLR GMFKRGNKSAAAKG
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integrating membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.