Recombinant Methylobacterium radiotolerans Protein CrcB homolog (crcB)

What is Methylobacterium radiotolerans and what makes it significant for research?

Methylobacterium radiotolerans is a fastidious, pink-pigmented, obligate aerobic Gram-negative bacillus that belongs to the genus Methylobacterium. It is a facultative methylotrophic bacterium capable of growing on one-carbon compounds such as formate, formaldehyde, and methanol . The organism is primarily found in environmental sources, particularly in association with plants, but can occasionally be isolated from clinical samples .

The significance of M. radiotolerans in research stems from several key characteristics:

• Its high G+C content (70.5%) and large genome size (7,389,282 bp with 7,166 genes)

• Its plant-associated beneficial properties including potential nitrogen fixation and cellulase production

• Its unusual ability to tolerate radiation, as suggested by its name

• Its potential role in clinical scenarios, particularly in immunocompromised patients

How is M. radiotolerans cultured and maintained in laboratory conditions?

M. radiotolerans requires specific cultivation conditions due to its fastidious nature. The organism grows poorly on commonly used culture media at standard incubation temperatures . Successful cultivation requires:

Temperature optimization: Growth occurs better at 32°C rather than the standard 37°C used for many clinical isolates .

Extended incubation: The organism requires prolonged incubation periods, with colonies typically becoming visible only after 72 hours on appropriate media .

Media selection: The bacterium shows better growth on CHROMagar Orientation and Sabouraud agar compared to standard blood agar plates .

Storage considerations: For the recombinant CrcB protein, storage at -20°C is recommended, with -80°C preferred for extended storage. Working aliquots can be maintained at 4°C for up to one week .

Aerobic conditions: As an obligate aerobe, the organism requires oxygen for growth, explaining why blood culture bottles containing the organism typically turn positive only in aerobic conditions .

What molecular techniques are most effective for identification and characterization of M. radiotolerans and its CrcB protein?

For definitive identification and characterization of M. radiotolerans and its CrcB protein, researchers should employ a multi-technique approach:

MALDI-TOF MS identification: Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry has proven highly effective for rapid identification of M. radiotolerans, even directly from positive blood culture bottles using systems such as Sepsityper. This technique can save approximately 3 days compared to traditional biochemical methods .

16S rDNA sequencing: Molecular confirmation through 16S rDNA sequencing provides definitive species identification. Primers such as FGPS6, FGPS1509, 16S-370f, 16-1080r, 16S-870f, and 16S-1924r can be utilized for comprehensive coverage of the 16S region .

Whole genome sequencing: For detailed genetic characterization, whole genome sequencing using platforms like Illumina MiSeq (2×300 bp paired-end reads) provides comprehensive genomic data. Assembly can be performed using de novo assembly tools such as those from CLC Bio .

Protein expression and purification: For the recombinant CrcB protein specifically:

• Expression systems using E. coli with appropriate expression vectors

• Purification using affinity chromatography (method depends on the tag used)

• Quality control through SDS-PAGE and Western blotting

• Confirmation of proper folding through circular dichroism spectroscopy

What experimental challenges are commonly encountered when working with the recombinant CrcB homolog protein, and how can they be addressed?

Researchers working with the recombinant CrcB homolog protein from M. radiotolerans frequently encounter several challenges:

Membrane protein solubility issues:

• Challenge: As a membrane protein with multiple transmembrane domains, CrcB can aggregate during expression and purification.

• Solution: Utilize specialized detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) during purification. Alternatively, consider fusion tags like maltose-binding protein (MBP) to enhance solubility.

Proper folding and functionality:

• Challenge: Ensuring the recombinant protein maintains native structure and function.

• Solution: Optimize expression conditions including temperature (often lower temperatures like 16-18°C improve folding), use specialized E. coli strains designed for membrane proteins, and consider in vitro refolding protocols if necessary.

Structural characterization:

• Challenge: Traditional structural biology techniques like X-ray crystallography are difficult with membrane proteins.

• Solution: Consider alternative approaches such as cryo-electron microscopy, nuclear magnetic resonance (for smaller fragments), or computational modeling based on homologous proteins.

Functional assays:

• Challenge: Developing appropriate assays to confirm ion channel activity.

• Solution: Implement liposome-based fluoride efflux assays using fluoride-sensitive probes or electrophysiological measurements in reconstituted systems.

How does the amino acid sequence of CrcB homolog relate to its predicted structural features and functional mechanisms?

The 143-amino acid sequence of the M. radiotolerans CrcB homolog protein reveals important structural and functional insights:

Transmembrane topology analysis:

Analysis of the amino acid sequence reveals a predicted topology with multiple transmembrane helices. The sequence pattern MSFTTCILVMIGGALGTLARYVVSVLSLPISRDLPWGTILINVTGSFIIGLFGTLTLAQG RFPVSENVRLFVMIGLCGGYTTFSSFSLQTLDLMRNGAVVRAMVNVCASVVLCVLAVALG HVVAAHWNGGAVQIAQVSIEEDG suggests:

• N-terminal region (residues 1-20): First transmembrane helix

• Middle region: Additional 2-3 transmembrane domains

• C-terminal region: Cytoplasmic domain involved in ion selectivity

Functional domains:

• The conserved motifs present in the sequence align with known fluoride channel structures

• Positively charged residues (arginine, lysine) in specific positions likely contribute to anion selectivity

• Highly conserved glycine residues potentially serve as hinge points for conformational changes during ion transport

Evolutionary conservation:
When aligned with CrcB homologs from other species, key residues involved in ion selectivity and gating show high conservation, while peripheral regions demonstrate greater variability. This pattern supports the core functional importance of the conserved regions.

What is the current understanding of the role of CrcB homolog in fluoride resistance and its potential biotechnological applications?

The CrcB homolog protein plays a critical role in fluoride resistance through its function as a fluoride-specific ion channel:

Mechanism of fluoride resistance:

• CrcB forms a selective channel that exports toxic fluoride ions from the cytoplasm

• This export maintains intracellular fluoride below inhibitory concentrations

• The protein likely functions as a homodimer or homotetramer based on structural studies of homologous proteins

Physiological relevance:

• Fluoride is ubiquitous in the environment and can inhibit phosphoryl transfer enzymes and enolase

• CrcB channels provide a primary defense mechanism against fluoride toxicity

• Environmental adaptations in M. radiotolerans likely include fluoride resistance mechanisms

Potential biotechnological applications:

• Development of biosensors for environmental fluoride detection

• Engineering of fluoride-resistant microorganisms for industrial processes

• Structural templates for designing selective ion channel modulators

• Bioremediation applications in fluoride-contaminated environments

What are the recommended protocols for expression and purification of recombinant M. radiotolerans CrcB homolog protein?

Optimized expression protocol:

• Vector construction:

  • Clone the full-length crcB gene (expression region 1-143) into a suitable expression vector

  • Include an appropriate affinity tag (His6, GST, or MBP) to facilitate purification

  • Consider codon optimization for E. coli expression

• Host strain selection:

  • Use specialized E. coli strains for membrane protein expression (C41/C43 or Lemo21)

  • Alternative hosts like Pichia pastoris may be considered for difficult expressions

• Expression conditions:

  • Culture in terrific broth (TB) or auto-induction media

  • Induce at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG

  • Lower temperature to 18°C post-induction

  • Continue expression for 16-20 hours

Purification workflow:

• Membrane fraction isolation:

  • Harvest cells and resuspend in buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl)

  • Disrupt by sonication or high-pressure homogenization

  • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour)

• Solubilization:

  • Solubilize membranes in buffer containing 1% DDM or equivalent detergent

  • Rotate at 4°C for 2 hours

  • Remove insoluble material by centrifugation

• Affinity purification:

  • Apply solubilized protein to appropriate affinity resin

  • Wash extensively with buffer containing 0.05% DDM

  • Elute with buffer containing the appropriate competitor

• Size exclusion chromatography:

  • Further purify by size exclusion chromatography

  • Assess purity by SDS-PAGE

  • Concentrate to desired concentration (typically 1-5 mg/mL)

• Storage:

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

What analytical techniques are most informative for studying the structure-function relationship of CrcB homolog?

Structural analysis techniques:

• Cryo-electron microscopy (cryo-EM):

  • Most suitable for membrane proteins like CrcB

  • Can provide near-atomic resolution structures

  • Requires highly pure, homogeneous protein preparations

• X-ray crystallography:

  • Challenging for membrane proteins but possible with:

    • Lipidic cubic phase crystallization

    • Addition of stabilizing antibody fragments

    • Thermostabilizing mutations

• Nuclear magnetic resonance (NMR):

  • Limited to smaller domains or fragments of CrcB

  • Provides dynamic information not available from static structures

• Molecular dynamics simulations:

  • Complements experimental structural data

  • Provides insights into ion permeation mechanisms

  • Predicts effects of mutations on channel function

Functional characterization:

• Electrophysiology:

  • Reconstitute purified protein in planar lipid bilayers

  • Measure single-channel conductance and ion selectivity

  • Determine voltage dependence and gating properties

• Fluoride flux assays:

  • Reconstitute protein in liposomes loaded with fluoride-sensitive probes

  • Measure fluoride transport rates under various conditions

• Mutagenesis studies:

  • Systematic alanine scanning to identify essential residues

  • Charge-neutralizing mutations to probe ion interaction sites

  • Cross-linking studies to determine oligomeric state

How can researchers effectively design experiments to investigate the biological significance of CrcB homolog in M. radiotolerans?

To investigate the biological significance of the CrcB homolog in M. radiotolerans, researchers should consider a multifaceted experimental approach:

Gene knockout and complementation studies:

• CRISPR-Cas9 genome editing:

  • Design guides targeting the crcB gene

  • Create knockout strains of M. radiotolerans

  • Confirm deletion by PCR and sequencing

• Phenotypic characterization:

  • Compare growth of wild-type and ΔcrcB strains in:

    • Media with varying fluoride concentrations

    • Different environmental stress conditions

    • Plant association models

• Complementation analysis:

  • Reintroduce wild-type and mutant versions of crcB

  • Assess rescue of fluoride sensitivity

  • Evaluate structure-function relationships

Transcriptomic and proteomic profiling:

• RNA-Seq analysis:

  • Compare gene expression in wild-type vs. ΔcrcB strains

  • Identify compensatory mechanisms and affected pathways

  • Analyze expression under fluoride stress conditions

• Proteomics:

  • Quantify protein abundance changes using LC-MS/MS

  • Identify interacting partners through co-immunoprecipitation

  • Characterize post-translational modifications

In vivo relevance in plant-microbe interactions:

• Plant colonization studies:

  • Inoculate plant roots with wild-type and ΔcrcB strains

  • Quantify colonization efficiency

  • Assess plant growth promotion effects

• Competitive fitness assays:

  • Co-inoculate plants with mixed populations of wild-type and ΔcrcB strains

  • Determine competitive index in various soil conditions

  • Evaluate long-term persistence in plant systems

What are the recommended approaches for studying the potential clinical significance of M. radiotolerans and its CrcB protein?

The clinical significance of M. radiotolerans and its CrcB protein requires careful investigation using the following approaches:

Clinical isolation and characterization:

• Optimized detection methods:

  • Extend blood culture incubation times (>48 hours)

  • Utilize MALDI-TOF MS for rapid identification

  • Implement molecular detection using species-specific PCR

• Clinical correlation studies:

  • Document patient demographics and clinical presentations

  • Analyze association with specific medical devices or procedures

  • Evaluate outcomes following different antimicrobial regimens

Antimicrobial susceptibility testing:

• Modified testing protocols:

  • Adjust incubation temperature to 32°C instead of 37°C

  • Extend incubation time to 72 hours for accurate reading

  • Use appropriate media that supports M. radiotolerans growth

• Interpretive criteria:

  • In the absence of specific breakpoints, consider extrapolation from Pseudomonas aeruginosa criteria

  • Document MIC distributions from clinical isolates

  • Correlate in vitro susceptibility with clinical outcomes

Table 1: Antimicrobial Susceptibility Patterns Reported for M. radiotolerans Clinical Isolates

*Interpretation based on P. aeruginosa breakpoints as no specific breakpoints exist for M. radiotolerans

Virulence and pathogenicity studies:

• Cell culture models:

  • Evaluate adhesion and invasion of epithelial cells

  • Assess survival within macrophages

  • Determine cytokine responses to bacterial challenge

• Biofilm formation:

  • Quantify biofilm formation on various materials

  • Evaluate contribution to medical device-associated infections

  • Test biofilm susceptibility to antimicrobial agents

• Role of CrcB in pathogenesis:

  • Investigate whether CrcB contributes to antimicrobial resistance

  • Explore potential role in adaptation to host environment

  • Evaluate as a potential diagnostic marker or therapeutic target

What emerging technologies might advance our understanding of CrcB homolog protein structure and function?

Several cutting-edge technologies show promise for advancing our understanding of the CrcB homolog protein:

Advanced structural biology approaches:

• Single-particle cryo-EM with improved detectors: Enables visualization of smaller membrane proteins at near-atomic resolution

• Microcrystal electron diffraction (MicroED): Allows structure determination from nanocrystals too small for traditional X-ray crystallography

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides insights into protein dynamics and ligand binding

Integrative computational methods:

• AlphaFold2 and RoseTTAFold: Deep learning-based protein structure prediction specifically optimized for membrane proteins

• Molecular dynamics simulations with polarizable force fields: Provides more accurate ion-protein interactions

• Markov state modeling: Captures rare conformational transitions in ion channels

Advanced functional characterization:

• Fluorescence-based single-molecule studies: Monitors conformational changes during ion transport

• High-throughput mutagenesis with deep sequencing: Comprehensively maps sequence-function relationships

• In-cell NMR spectroscopy: Studies protein structure and dynamics in the native cellular environment

How might comparative genomics and evolutionary analysis of CrcB homologs inform our understanding of fluoride resistance mechanisms?

Comparative genomics and evolutionary analysis offer powerful insights into fluoride resistance mechanisms involving CrcB homologs:

Phylogenetic distribution and conservation:

• Analyze CrcB distribution across bacterial, archaeal, and eukaryotic genomes

• Identify co-occurring genes that might function in fluoride resistance

• Determine how environmental niches correlate with CrcB presence/absence

Sequence conservation patterns:

• Compare sequence conservation across diverse CrcB homologs

• Identify highly conserved residues likely essential for function

• Detect signatures of positive selection indicating adaptive evolution

Genomic context analysis:

• Examine gene neighborhoods around crcB in diverse genomes

• Identify potential operons or functional gene clusters

• Investigate regulatory elements controlling crcB expression

Horizontal gene transfer patterns:

• Assess evidence for horizontal transfer of fluoride resistance genes

• Identify mobile genetic elements associated with crcB

• Determine if fluoride resistance genes show different evolutionary trajectories than core genomes

What potential exists for developing novel biotechnological applications based on M. radiotolerans and its CrcB protein?

M. radiotolerans and its CrcB protein hold considerable potential for various biotechnological applications:

Environmental biotechnology:

• Bioremediation of fluoride-contaminated environments: Engineered strains with enhanced fluoride tolerance

• Biosensors for fluoride detection: CrcB-based reporters for environmental monitoring

• Plant growth promotion: Utilizing M. radiotolerans as a beneficial endophyte in agriculture

Protein engineering and synthetic biology:

• Designer ion channels: Modifying CrcB selectivity for other ions of interest

• Minimal cell projects: Including essential fluoride resistance in synthetic organisms

• Biomembrane technologies: Incorporating CrcB into artificial membrane systems for sensing or separation applications

Pharmaceutical and medical applications:

• Antimicrobial target exploration: Investigating fluoride channels as novel antibacterial targets

• Drug delivery systems: Exploring methylobacteria as potential therapeutic delivery vehicles

• Diagnostic tools: Developing rapid detection methods for rare methylobacterial infections