Recombinant Methylobacterium sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant Methylobacterium sp. ATP synthase subunit a (atpB) is a full-length protein (UniProt ID: B0ULY1, residues 1–251) fused to an N-terminal histidine tag for purification. Expressed in Escherichia coli, this subunit forms part of the membrane-embedded F<sub>O</sub> domain of ATP synthase, which facilitates proton translocation during ATP synthesis . Key specifications include:

ParameterDetail
Catalog NumberRFL5719MF
Host OrganismMethylobacterium sp.
Expression SystemE. coli
TagN-terminal His tag
Molecular Weight~28 kDa (theoretical)
ApplicationStructural studies, enzyme inhibition assays, ATP synthase reconstitution

Functional Role in ATP Synthase

ATP synthase (F<sub>1</sub>F<sub>O</sub>-ATPase) couples proton translocation to ATP synthesis. Subunit a contributes to:

  • Proton Channeling: Directs H<sup>+</sup> flow from the periplasm to the c-ring, driving rotation of the γ-subunit .

  • Energy Conservation: Maintains PMF under hypoxic conditions, critical for bacterial survival in fluctuating environments .

  • Latent ATP Hydrolysis Regulation: In mycobacteria, subunit α’s C-terminus interacts with γ to inhibit ATP hydrolysis, a feature potentially conserved in α-proteobacteria like Methylobacterium .

4.1. Enzyme Reconstitution Studies

Recombinant atpB enables in vitro assembly of functional ATP synthase. For example:

  • Proteoliposomes containing reconstituted ATP synthase can measure ATP synthesis rates under controlled PMF .

  • Inhibitor screening (e.g., bedaquiline analogs) uses subunit a to assess drug binding and proton translocation disruption .

4.3. Antimicrobial Development

Subunit a is a potential drug target due to its role in energy metabolism. Inhibitors targeting conserved motifs (e.g., proton channels) could disrupt bacterial viability .

Comparative Analysis with Homologs

FeatureMethylobacterium sp. atpBMycobacterium sp. atpBHelicobacter pylori atpB
Length (aa)251226–251226
Key MotifsHis tag, proton channelαCTD, γ-loopProton channel
Expression HostE. coliE. coliE. coli
Functional StudiesLimitedExtensive Moderate

Future Directions

  • Mechanistic Studies: Elucidate rotary coupling between subunit a and the c-ring in Methylobacterium.

  • Inhibitor Design: Screen compounds targeting proton translocation motifs unique to α-proteobacteria.

  • Biotechnological Applications: Engineer ATP synthase for bioenergy applications, leveraging recombinant atpB’s stability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; M446_6944; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Methylobacterium sp. (strain 4-46)
Target Names
atpB
Target Protein Sequence
MAVKLDPIHQFELKPLVSFGHIGHQHIAFTQSALYMFAAVGIIALITLVATRQRALVPGR MQSLAEAFYEFIASTVHQSAGHGSERFVPLVFSLFMFVLVLNLFGMIPYAFTVTSHIIVT FMLALVVILTVVIYGFMAHGVHFLDLFVPPGVPGWLKPLIVAIEVVSFISRPISLSVRLF ANMLAGHIALKIFAGFVPALLAAGIWGILSPLPLALSVAITALEMLVAVLQAYVFATLTS IYLSDALHPGH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across membranes.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should researchers optimize storage and reconstitution of Recombinant Methylobacterium sp. ATP synthase subunit a?

Optimal storage and reconstitution of this membrane protein is critical for maintaining its structural integrity and function. The lyophilized protein should be stored at -20°C/-80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles which can compromise protein stability. For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Store working aliquots at 4°C for up to one week to minimize degradation

Repeated freeze-thaw cycles should be avoided as they can significantly reduce protein activity and integrity .

What expression systems yield functional Recombinant Methylobacterium sp. ATP synthase subunit a?

E. coli expression systems are predominantly used for the production of Recombinant Methylobacterium sp. ATP synthase subunit a due to their high efficiency and scalability. The highly hydrophobic nature of subunit a presents challenges for expression and purification, requiring optimization of several parameters:

Expression ParameterOptimization Strategy
Host strainBL21(DE3) or C41(DE3) for membrane proteins
Induction temperatureLower temperature (16-25°C) to enhance proper folding
Induction timeExtended periods (16-24 hours) for optimal expression
IPTG concentrationLower concentrations (0.1-0.5 mM) to prevent inclusion bodies
Detergent selectionNon-ionic detergents for membrane protein solubilization

The N-terminal His tag facilitates purification via immobilized metal affinity chromatography (IMAC) while maintaining protein functionality .

How does the C-terminal domain of ATP synthase subunit a influence ATPase activity in bacterial systems?

The C-terminal domain (CTD) of ATP synthase subunit α exhibits a critical regulatory function in controlling ATP hydrolysis in bacterial systems. Research on mycobacterial ATP synthases has revealed that the extended C-terminal domain (αCTD) serves as the primary element in the self-inhibition mechanism of ATP hydrolysis in both tuberculosis and non-tuberculous mycobacteria.

Structural studies using cryo-electron microscopy of mycobacterial F-ATP synthases demonstrate that this domain undergoes conformational changes that correlate with nucleotide occupancy in catalytic sites. Deletion mutant studies provide compelling evidence that removing portions of the αCTD significantly increases ATP hydrolytic activity, confirming its inhibitory role:

ATP Synthase VariantATP Hydrolytic Activity (μmol min⁻¹ mg⁻¹)Change
Wild type F₁-ATPase0.04Baseline
αΔ514-548 deletion~0.6-0.8~15-20× increase
αΔ532-548 deletion~0.4-0.6~10-15× increase
αΔ542-548 deletion~0.1~2.5× increase

Rotational studies indicate that the transition between the inhibition state mediated by the αCTD and the active state is a rapid process, suggesting a dynamic regulatory mechanism .

While this data is from Mycobacterium studies, it provides valuable insights into potential regulatory mechanisms that may be present in Methylobacterium sp. ATP synthase, guiding experimental design for researchers investigating regulatory domains in this system.

What experimental approaches can delineate the proton translocation pathway in Methylobacterium sp. ATP synthase subunit a?

Investigating the proton translocation pathway in Methylobacterium sp. ATP synthase subunit a requires multiple complementary approaches:

  • Site-directed mutagenesis: Systematically alter conserved charged residues (particularly arginine and aspartate residues) in the transmembrane regions to identify those essential for proton translocation. Each mutant should be assessed for:

    • ATP synthesis capability

    • Proton pumping efficiency

    • Membrane potential generation

  • Hydrogen/deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of the protein accessible to solvent and potentially involved in the proton path.

  • Molecular dynamics simulations: Using the known amino acid sequence, researchers can model potential water channels and proton wire networks within the protein structure.

  • Cross-linking studies: Chemical cross-linking combined with mass spectrometry can reveal proximity relationships between subunit a and other components of the F₀ sector.

  • Electron paramagnetic resonance (EPR) spectroscopy: By introducing spin labels at strategic positions, researchers can monitor conformational changes associated with proton movement.

The integrative data from these approaches can be mapped to the structure to build a comprehensive model of the proton translocation mechanism, which is essential for understanding the catalytic function of ATP synthase .

How can cryo-electron microscopy advance structural understanding of Methylobacterium sp. ATP synthase complexes?

Cryo-electron microscopy (cryo-EM) has revolutionized our understanding of ATP synthase structure and function. For Methylobacterium sp. ATP synthase, this technique offers several advantages:

  • Visualization of the intact complex: Cryo-EM permits visualization of the entire ATP synthase complex embedded in a lipid environment, preserving native interactions between subunits.

  • Capture of multiple conformational states: The technique can resolve different rotational states within a single sample preparation, revealing the structural transitions during the catalytic cycle. Studies of mycobacterial ATP synthase have identified not only the three main catalytic states but also eight substates that illustrate structural changes occurring during a complete 360° cycle .

  • Identification of species-specific features: Cryo-EM can resolve unique structural elements that distinguish Methylobacterium sp. ATP synthase from other bacterial and eukaryotic homologs, potentially revealing:

    • Unique regulatory domains

    • Species-specific subunit interactions

    • Conformational changes during catalysis

  • Resolution of membrane-embedded regions: The hydrophobic F₀ sector, including subunit a, is difficult to study by crystallography but can be resolved by cryo-EM in a native-like environment.

Implementation requires:

  • Preparation of highly pure, homogeneous protein samples

  • Optimization of detergent or nanodisc reconstitution

  • Data collection on high-end electron microscopes

  • Advanced image processing to separate conformational states

The resulting structural data would provide a foundation for understanding the mechanism and regulation specific to Methylobacterium sp. ATP synthase .

What regulatory considerations apply when conducting research with Recombinant Methylobacterium sp. ATP synthase subunit a?

Research involving Recombinant Methylobacterium sp. ATP synthase subunit a must comply with institutional biosafety regulations and NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Key regulatory considerations include:

  • Institutional Biosafety Committee (IBC) approval: At many institutions (like Stanford University), ALL research involving recombinant DNA must comply with NIH Guidelines, and non-exempt research requires approval from the Administrative Panel on Biosafety (APB) .

  • Risk assessment considerations:

    • The use of E. coli as an expression system typically falls under NIH Guidelines Section III-D or III-E

    • Expression of membrane proteins like ATP synthase subunit a generally does not present significant biohazards as they lack toxin activity

  • Documentation requirements:

    • Detailed protocols for handling recombinant organisms

    • Standard operating procedures for laboratory work

    • Records of staff training on biosafety procedures

  • Waste management protocols:

    • Proper decontamination and disposal of bacterial cultures

    • Management of contaminated materials according to institutional guidelines

Researchers should consult their institutional biosafety officer to ensure all regulatory requirements are met before initiating experiments with this recombinant protein .

How can structural insights from mycobacterial ATP synthases inform research on Methylobacterium sp. ATP synthase?

Structural studies of mycobacterial ATP synthases provide valuable comparative insights that can be applied to research on Methylobacterium sp. ATP synthase:

  • Identification of conserved functional elements: Mycobacterial ATP synthases contain several unique structural elements critical for function:

    • Extended C-terminal domain (αCTD) that regulates ATP hydrolysis

    • Unique mycobacterial γ-loop essential for ATP formation

    • Inserted δ-domain involved in regulatory mechanisms

These elements may have homologous counterparts in Methylobacterium sp. ATP synthase that could be identified through sequence alignment and targeted for functional studies .

  • Drug target potential: Studies on mycobacterial ATP synthases have identified species-specific structural features that can be targeted by antibiotics like bedaquiline (BD). Similar unique features in Methylobacterium sp. ATP synthase could represent potential targets for species-specific inhibitors .

  • Mechanistic insights: The resolution of multiple substates during the catalytic cycle of mycobacterial ATP synthase provides a framework for understanding the rotary mechanism. These insights can guide the design of experiments to investigate whether Methylobacterium sp. ATP synthase employs similar mechanisms or has evolved distinct functional adaptations .

  • Regulatory mechanisms: The auto-inhibition mechanism identified in mycobacterial ATP synthases suggests that similar regulatory control might exist in Methylobacterium sp., warranting investigation of potential auto-inhibitory domains .

Researchers should conduct careful phylogenetic analyses to determine the degree of conservation between these systems before directly applying structural insights from mycobacterial studies.

What are the optimal conditions for assessing ATP synthase activity in reconstituted Methylobacterium sp. ATP synthase systems?

Functional assessment of reconstituted Methylobacterium sp. ATP synthase requires careful optimization of experimental conditions to measure both ATP synthesis and hydrolysis activities:

ATP Synthesis Activity Assay:

  • Reconstitution parameters:

    • Liposome composition: E. coli polar lipids or synthetic mixtures containing phosphatidylcholine, phosphatidylethanolamine, and cardiolipin

    • Protein-to-lipid ratio: Typically 1:50 to 1:100 (w/w)

    • Reconstitution method: Detergent dialysis or rapid dilution

  • Assay conditions:

    • Buffer: 20-50 mM HEPES or Tris-HCl, pH 7.5-8.0

    • Salt: 50-100 mM KCl or NaCl

    • Substrate: 1-5 mM ADP

    • Phosphate source: 5-10 mM inorganic phosphate

    • Divalent cation: 2-5 mM MgCl₂

    • pH gradient generation: Acidification of internal liposome space (pH ~5.5) versus external buffer (pH ~8.0)

    • Membrane potential generation: K⁺ gradient with valinomycin

  • Detection methods:

    • Luciferin/luciferase bioluminescence assay for real-time ATP production

    • HPLC analysis of nucleotides

    • Coupled enzyme assays (hexokinase/glucose-6-phosphate dehydrogenase)

ATP Hydrolysis Activity Assay:

  • Assay conditions:

    • Buffer: 50 mM Tris-HCl, pH 8.0

    • Salt: 100 mM KCl

    • Substrate: 1-5 mM ATP

    • Divalent cation: 2-5 mM MgCl₂

  • Detection methods:

    • Colorimetric measurement of released inorganic phosphate

    • Coupled enzyme assay (pyruvate kinase/lactate dehydrogenase) with spectrophotometric monitoring of NADH oxidation

Optimal temperature for both assays is typically 30-37°C, reflecting the physiological growth temperature of Methylobacterium species .

What strategies can resolve experimental challenges in site-directed mutagenesis studies of Methylobacterium sp. ATP synthase subunit a?

Site-directed mutagenesis of Methylobacterium sp. ATP synthase subunit a presents several challenges due to the hydrophobic nature of this membrane protein. Effective strategies to overcome these obstacles include:

  • Codon optimization:

    • Adapt the coding sequence to E. coli codon usage preferences

    • Remove rare codons that may cause translational pausing

    • Optimize GC content for stable expression

  • Vector selection:

    • Use low-copy vectors for initial cloning to minimize potential toxicity

    • Consider inducible expression systems with tight regulation (e.g., pET system with T7 promoter)

    • Include fusion partners that can enhance solubility (e.g., MBP, SUMO)

  • Mutagenesis approaches:

    • Quick-Change mutagenesis for single amino acid substitutions

    • Gibson Assembly for multiple mutations or domain replacements

    • Golden Gate Assembly for systematic mutational scanning

  • Mutation verification:

    • Complete sequencing of the entire gene to confirm intended mutations

    • Verification of protein expression by Western blotting with anti-His antibodies

    • Mass spectrometry analysis to confirm incorporation of mutations

  • Phenotypic assessment:

    • ATP synthesis/hydrolysis assays to evaluate functional consequences

    • Proton translocation measurements to assess ion channel function

    • Protein-protein interaction studies to determine effects on complex assembly

Mutation TypeRecommended TechniqueSuccess RateVerification Method
Single point mutationsQuick-Change PCR80-90%Sanger sequencing
Multiple mutations (≤3)Multi-site Quick-Change60-70%Sanger sequencing
Domain swapsGibson Assembly40-60%NGS sequencing
Alanine scanningGolden Gate Assembly70-80%Sanger sequencing

For particularly challenging mutations in highly hydrophobic regions, consider a two-step approach: first introduce a silent mutation that creates a unique restriction site, then use restriction enzyme-based cloning for the functional mutation .

How can researchers differentiate between specific and non-specific effects when evaluating inhibitors of Methylobacterium sp. ATP synthase?

Distinguishing specific from non-specific inhibitory effects on Methylobacterium sp. ATP synthase requires a comprehensive approach:

  • Dose-response relationships:

    • Establish complete dose-response curves (10⁻⁹ to 10⁻⁴ M range)

    • Calculate IC₅₀ values and Hill coefficients

    • Compare potency against purified enzyme versus membrane preparations

    • True specific inhibitors typically show sigmoidal dose-response curves with Hill coefficients near 1.0

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to quantify binding affinity and thermodynamics

    • Surface plasmon resonance (SPR) to determine association/dissociation kinetics

    • Fluorescence-based binding assays using labeled inhibitors

    • Competition assays with known ligands/substrates

  • Mechanistic investigations:

    • Determine mode of inhibition (competitive, non-competitive, uncompetitive, mixed)

    • Assess effects on different partial reactions (ATP synthesis vs. hydrolysis)

    • Evaluate impact on proton translocation separately from catalytic activity

  • Selectivity profiling:

    • Test against related ATP synthases from different organisms

    • Evaluate effects on other membrane proteins and ATPases

    • Assess membrane permeabilization effects using liposome dye-release assays

  • Structural confirmation:

    • Generate resistant mutants and identify resistance mutations

    • Use structural techniques (cryo-EM, HDX-MS) to confirm binding sites

    • Molecular docking and MD simulations to predict binding modes

Control ExperimentPurposeExpected Outcome for Specific Inhibitor
Detergent controlsDetect membrane-disruptive effectsNo activity in presence of detergent
Pre-incubation time courseDistinguish slow-binding from fast-binding inhibitorsConsistent inhibition regardless of pre-incubation time
Protein concentration dependenceDetect non-specific aggregationInhibition independent of protein concentration
Reversibility testConfirm specific bindingActivity recovery after inhibitor removal
Known ATP synthase inhibitorsPositive controlsSimilar inhibition profiles for same-site inhibitors

These approaches collectively provide strong evidence for the specificity of inhibitory effects and help identify true ATP synthase inhibitors versus compounds with non-specific membrane effects or protein denaturing properties .

How might comparative genomics inform evolutionary adaptations in Methylobacterium sp. ATP synthase subunit a?

Comparative genomics approaches offer powerful insights into the evolutionary adaptations of Methylobacterium sp. ATP synthase subunit a that may correlate with the organism's unique ecological niche:

  • Phylogenetic analysis across bacterial phyla:

    • Construct comprehensive phylogenetic trees of ATP synthase subunit a sequences

    • Identify lineage-specific insertions, deletions, and substitutions

    • Correlate sequence divergence with ecological adaptations (methylotrophy, plant association)

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Map selection hotspots to functional domains and structural elements

    • Compare conservation patterns between obligate methylotrophs and facultative methylotrophs

  • Structural element conservation:

    • Examine conservation of the C-terminal regulatory domain identified in mycobacterial systems

    • Assess presence/absence of specialized loops and insertions found in other bacterial ATP synthases

    • Identify unique structural features in Methylobacterium that may correlate with its plant-associated lifestyle

  • Horizontal gene transfer assessment:

    • Analyze GC content and codon usage patterns for evidence of horizontal acquisition

    • Identify potential recombination events in ATP synthase operons

    • Evaluate synteny and gene order conservation around the ATP synthase genes

These comparative approaches could reveal adaptive features that enhance ATP synthase function in the plant-associated, microaerobic environment where many Methylobacterium species thrive, potentially identifying novel regulatory mechanisms or structural adaptations unique to this genus.

What potential applications exist for engineered variants of Methylobacterium sp. ATP synthase subunit a?

Engineered variants of Methylobacterium sp. ATP synthase subunit a offer several promising research and biotechnological applications:

  • Bioenergetic research tools:

    • Incorporation of fluorescent probes at strategic positions to monitor conformational changes during catalysis

    • Engineering of cysteine-free variants for site-specific labeling studies

    • Creation of chimeric proteins to investigate subunit-specific functions

  • Synthetic biology applications:

    • Development of ATP synthase variants with altered ion specificity (H⁺ → Na⁺)

    • Engineering of temperature-stable variants for industrial applications

    • Creation of regulatory circuit-responsive ATP synthases for metabolic engineering

  • Therapeutic target validation:

    • Generation of inhibitor-resistant mutants to validate binding sites

    • Development of minimal functional models to screen for structure-specific inhibitors

    • Engineering of reporter constructs for high-throughput inhibitor screening

  • Biophysical research platforms:

    • Single-molecule studies using immobilized, engineered ATP synthases

    • Nanoscale rotary motors for nanotechnology applications

    • Energy conversion devices for synthetic cellular systems

These applications require sophisticated protein engineering approaches, including:

  • Computational design of stable variants

  • Directed evolution to optimize desired properties

  • Structure-guided rational design based on comparative analysis with other bacterial ATP synthases

Success in these engineering efforts would not only advance our fundamental understanding of ATP synthase function but could also lead to novel biotechnological applications leveraging the unique properties of Methylobacterium sp. ATP synthase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.