Recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methylobacterium sp. ATP Synthase Subunit b/b' (atpG)

ATP synthase, also known as F0F1-ATPase, is a ubiquitous enzyme that synthesizes adenosine triphosphate (ATP) in living cells . It is a rotary molecular machine that uses a proton gradient across the cell membrane to drive the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate . In bacteria, the ATP synthase complex is composed of two main domains: F0 and F1 . The F0 domain is embedded in the cell membrane and contains the proton channel, while the F1 domain is located in the cytoplasm and contains the catalytic site for ATP synthesis .

The ATP synthase subunit b/b' (atpG) is a component of the F0 domain of the ATP synthase complex in Methylobacterium sp. and other bacteria . In mycobacteria, the peripheral stalk (PS) of ATP synthase is made of two proteins, bδ and b′. The bδ-subunit is a covalent fusion of the separate b- and δ-subunits found in many other eubacteria . The b′-subunit is orthologous (but not identical) to the b-component of the bδ-subunit, and both the b-component and the b′-subunit have N-terminal hydrophobic regions, each capable of forming single transmembrane α-helices . The b/b' subunits are essential for the structural integrity and function of the ATP synthase complex . Specifically, these subunits help maintain the connection between the static stator component and the rotating c-ring, which is required for coupling ATP synthesis to the transmembrane proton-motive force (pmf) .

Recombinant ATP synthase subunit b/b' (atpG) refers to the subunit that is produced using recombinant DNA technology. This involves isolating the gene encoding the subunit from Methylobacterium sp., cloning it into an expression vector, and expressing it in a host organism such as Escherichia coli . The recombinant protein can then be purified and used for various research purposes, such as studying its structure, function, and interactions with other proteins .

Structure of ATP Synthase Subunit b/b'

The structure of the ATP synthase subunit b/b' has been studied in several bacterial species, including Mycobacterium smegmatis . The b/b' subunits form a stalk-like structure that connects the F1 domain to the F0 domain . In M. smegmatis, the PS is a complex of a single b′-subunit and the unique bδ-subunit. The bδ-subunit has been described previously as a fusion protein with a linking region between the C-terminal region of the b-subunit and the N-terminal region of the δ-subunit with the δ-subunit component bound noncovalently to the N-terminal regions of the three α-subunits . The bδ-subunit consists of 16 α-helices with a β-strand separating bδH14 and bδH15, with three additional β-strands between bδH15 and bδH16 . These structural elements form three separate domains. The N-terminal “b” domain is similar to those of other bacterial b-subunits . Its structure consists of bδH1 to bδH3 and is similar to the equivalent region of a canonical bacterial b-subunit with bδH1 spanning the bacterial IPM . α-Helix bδH1 and the equivalent, but nonassociated, b′H1 bind to separate regions of the a-subunit and help to maintain the integrity of the transmembrane proton pathway .

Function of ATP Synthase Subunit b/b'

The ATP synthase subunit b/b' plays a critical role in the function of the ATP synthase complex . It is essential for the structural integrity of the enzyme and is involved in the proton translocation pathway . In other bacterial ATP synthases of known structure, the corresponding α-helices interact with the final component of the stator, the single a-subunit, and hold it in contact with the rotating c-ring in order to maintain the integrity of the two proton half-channels, thereby maintaining the coupling of ATP synthases to the transmembrane pmf .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will accommodate your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments default to standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.

Synonyms
atpF2; atpG; M446_6946; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Methylobacterium sp. (strain 4-46)
Target Names
atpF2
Target Protein Sequence
MAQPTPHAGLQEGLIHEPASEHGGGFPPFQSTTFAAQILWLAIAFGLLYYLMSRVAVPRI AGLLHDRQARLAADLDEASRMKTGADSARGAYERSLKEAQDKAKGIAQATRDSLAAEAET RRKALEADLAAKLAESEAQIRARTATAMGSVREVAADAATAIVERLIGQSPDRAAVEAAY DRTQTVH
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, containing the extramembranous catalytic core, and F0, containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, through a rotary mechanism involving the central stalk subunits, to proton translocation. The b' subunit is a component of the F0 channel, forming part of the peripheral stalk and connecting F1 to F0. It is a diverged and duplicated form of the b subunit found in plants and photosynthetic bacteria.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b/b' (atpG) in Methylobacterium sp. bioenergetics?

ATP synthase subunit b/b' (atpG) serves as a critical component of the peripheral stalk in the F₀ sector of the F₁F₀-ATP synthase complex. This peripheral stalk functions as a stator, anchoring the catalytic F₁ portion to the membrane-embedded F₀ portion, allowing for the rotational catalysis necessary for ATP synthesis .

In Methylobacterium species, which are aerobic facultative methylotrophs capable of growing on one-carbon compounds, the ATP synthase complex is particularly significant for energy generation during methylotrophic metabolism . The b/b' subunit is essential for maintaining structural integrity of the complex and ensuring efficient coupling of the proton gradient to ATP synthesis.

Unlike the ATP synthase in some other bacterial species, the Methylobacterium complex likely contains specialized adaptations for its ecological niche. Research on related bacteria shows that ATP synthase components are crucial for survival under various environmental conditions, with Methylobacterium species demonstrating remarkable temperature tolerance (surviving at 50-60°C) and forming biofilms on various surfaces .

What expression systems are most effective for producing recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG)?

Based on current research findings, several expression systems have demonstrated effectiveness for producing recombinant ATP synthase subunits, with specific advantages depending on research objectives:

Escherichia coli Expression System

E. coli remains the most widely utilized host for recombinant ATP synthase subunit expression, as evidenced by successful production of related ATP synthase components from Rhodopseudomonas palustris . The E. coli system offers several advantages:

  • Utilizes T7 promoter-based expression vectors (pET series)

  • Allows for N-terminal or C-terminal tagging (commonly His-tag) for simplified purification

  • Provides high protein yields under optimized conditions

  • Offers cost-effective production at laboratory scale

Baculovirus Expression System

For more complex membrane proteins, the baculovirus system has demonstrated success in expressing ATP synthase subunits, including the ATP synthase subunit a (atpB) from Methylobacterium sp. :

  • Provides superior folding for complex membrane proteins

  • Offers higher yields than mammalian expression systems

  • Supports post-translational modifications not available in bacterial systems

  • Scales effectively for larger production requirements

Critical Optimization Parameters

Regardless of the chosen expression system, several factors significantly impact recombinant protein production success:

Optimization FactorCritical ParametersImpact on Yield
Codon optimizationHost-specific adaptation2-10× increase
Fusion tagsHis, GST, MBP selectionImproved solubility
Induction conditionsTemperature, inducer concentrationPrevents inclusion bodies
Host strain selectionBL21(DE3), Rosetta for E. coliAddresses codon bias
Medium compositionRich vs. minimal, supplementsAffects final biomass

For Methylobacterium sp. ATP synthase subunit b/b' (atpG), the E. coli expression system typically offers the most practical starting point due to its simplicity and cost-effectiveness, with baculovirus as a secondary option if expression proves challenging .

How is the structural integrity of recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG) typically assessed?

Evaluating the structural integrity of recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG) requires multiple complementary analytical approaches:

Primary Protein Analysis

SDS-PAGE remains the foundational method for assessing protein purity and integrity:

  • Standard quality thresholds require >85-90% purity as determined by densitometry analysis

  • Appropriate molecular weight confirmation (expected size based on sequence)

  • Band sharpness indicating homogeneous protein preparation

  • Absence of degradation products or aggregates

Identity Confirmation Methods

Western blotting provides specific protein identification:

  • Uses antibodies targeting the protein itself or fusion tags (e.g., anti-His for His-tagged proteins)

  • Confirms the identity even in complex mixtures

  • Can detect even small amounts of the target protein or degradation products

Structural Homogeneity Assessment

Size exclusion chromatography (SEC) provides critical information about protein oligomerization state:

  • Reveals aggregation, oligomerization, or degradation states

  • Measures protein homogeneity in native buffer conditions

  • Can be coupled with multi-angle light scattering (SEC-MALS) for absolute molecular weight determination

Advanced Structural Analysis

Mass spectrometry provides detailed molecular characterization:

  • MALDI-TOF or ESI-MS confirms exact molecular weight

  • LC-MS/MS peptide mapping verifies sequence coverage and modifications

  • Identifies potential post-translational modifications or truncations

Functional Verification

Activity testing confirms proper folding and function:

  • Reconstitution experiments in liposomes to assess membrane integration

  • Binding assays with other ATP synthase subunits to verify interaction capacity

  • ATP synthesis/hydrolysis assays for reconstituted complexes

A comprehensive integrity assessment workflow typically includes SDS-PAGE during purification, identity confirmation by Western blotting, homogeneity verification by SEC, mass spectrometry for molecular characterization, and functional assays to confirm biological activity.

What storage conditions optimize stability of recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG)?

Optimal storage conditions for recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG) vary depending on storage duration and downstream applications:

Short-term Storage Recommendations

For working stocks used within one week:

  • Store at 4°C in appropriate buffer

  • Avoid repeated freeze-thaw cycles (explicitly mentioned in sources)

  • Use sterile conditions to prevent microbial contamination

  • Monitor protein stability periodically by analytical methods

Long-term Storage Parameters

For extended preservation periods:

  • Store at -20°C/-80°C with proper cryoprotectants

  • Typical shelf life for liquid formulations: approximately 6 months at -20°C/-80°C

  • Lyophilized (freeze-dried) formulations extend shelf life to approximately 12 months

  • Always aliquot to avoid repeated freeze-thaw cycles

Buffer Composition Effects

Buffer composition significantly impacts protein stability:

  • Tris/PBS-based buffers at pH 8.0 are commonly utilized

  • Addition of glycerol (5-50% final concentration) prevents ice crystal formation

  • Default final glycerol concentration of 50% is recommended for maximum protection

  • Some preparations include 6% trehalose as an additional cryoprotectant

Reconstitution Protocol for Lyophilized Protein

When working with lyophilized protein:

  • Briefly centrifuge the vial before opening to collect all material

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration

  • Add glycerol to 5-50% final concentration for storage

  • Aliquot appropriately to minimize freeze-thaw cycles

These recommendations are based on established protocols for recombinant ATP synthase subunits from related organisms and provide a foundation for maintaining optimal protein stability throughout experimental timelines.

How does the structure of Methylobacterium sp. ATP synthase subunit b/b' (atpG) compare to homologous proteins in other bacterial species?

The structure of ATP synthase subunit b/b' shows both conserved features and species-specific adaptations across bacterial species, reflecting evolutionary specialization:

Conserved Structural Features

All bacterial ATP synthase b/b' subunits share fundamental structural elements:

  • N-terminal hydrophobic domain forming a membrane-spanning alpha helix

  • Extended C-terminal region with high proportion of charged and polar residues

  • Coiled-coil structure in the dimerization domain

  • F₁-interaction domain extending into the cytoplasm

Comparative Structural Analysis

SpeciesN-terminal DomainDimerization DomainF₁-Interaction DomainUnique Features
Methylobacterium sp.Hydrophobic membrane anchorCoiled-coil structureExtended alpha helixHigher proportion of alanine residues
E. coliSingle transmembrane helixRigid coiled-coilInteracts with δ and α subunitsContains "DELSEED" regulatory region
MycobacteriaSimilar to other bacteriaContains species-specific sequencesInteracts with mycobacteria-specific α C-terminusContains unique regulatory elements for ATP hydrolysis inhibition
Rhodopseudomonas palustrisSimilar to MethylobacteriumCoiled-coil structureConserved F₁-binding motifsHigh sequence similarity to Methylobacterium

Functional Implications of Structural Differences

The structural variations directly impact function:

  • Mycobacterial ATP synthase contains specific features like the C-terminal domain of subunit α (α533-545) that regulates ATP hydrolysis through interaction with subunit γ

  • Deletion of this domain stimulates ATPase activity while reducing ATP synthesis

  • Similar regulatory mechanisms likely exist in Methylobacterium sp. ATP synthase, adapted to its methylotrophic lifestyle

  • The peripheral stalk formed by b/b' subunits prevents rotation of the F₁ sector during catalysis, with structural adaptations affecting energy coupling efficiency

These structural comparisons provide insights into how Methylobacterium sp. has adapted its ATP synthase components to optimize energy production under its specific metabolic conditions.

What experimental approaches can effectively study the interaction between Methylobacterium sp. ATP synthase subunit b/b' (atpG) and other complex subunits?

Multiple complementary experimental approaches are essential for comprehensive characterization of protein-protein interactions involving Methylobacterium sp. ATP synthase subunit b/b':

Biochemical Interaction Analysis

Co-immunoprecipitation (Co-IP) provides direct evidence of protein interactions:

  • Utilizes antibodies against one subunit to precipitate the entire complex

  • Western blotting identifies which other subunits are co-precipitated

  • Can be performed with tagged recombinant proteins (e.g., His-tagged proteins)

  • Particularly useful for identifying stable, high-affinity interactions

Cross-linking studies provide spatial relationship information:

  • Chemical cross-linkers covalently connect proteins in close proximity

  • Mass spectrometry identifies cross-linked peptides

  • Provides data about which regions are in close contact

  • Cross-linking coupled with mass spectrometry maps interaction interfaces

Biophysical Characterization Methods

Surface Plasmon Resonance (SPR) quantifies binding parameters:

  • Measures real-time binding kinetics and affinity

  • Provides quantitative constants (KD, kon, koff)

  • Allows testing of binding under various buffer conditions

  • Can detect conformational changes upon binding

Isothermal Titration Calorimetry (ITC) measures thermodynamic parameters:

  • Quantifies binding enthalpy, entropy, and stoichiometry

  • Requires no labeling or immobilization

  • Provides complete thermodynamic profile of interactions

  • Can detect subtle binding differences between mutant proteins

Functional Reconstitution Approaches

Liposome reconstitution studies assess functional interactions:

  • Recombinant subunits combined to reconstruct functional complexes

  • Activity assays (ATP synthesis/hydrolysis) confirm proper assembly

  • Search result #1 describes ATP synthesis measurement using a continuous luciferase assay

  • Direct measurement of the functional consequences of specific interactions

Example protocol from literature:

  • Reconstitute purified ATP synthase components into liposomes

  • Collect proteoliposomes by centrifugation (150,000× g, 30 min)

  • Resuspend in appropriate buffer (e.g., 100 mM Tris, 100 mM maleic acid, 5 mM MgCl₂, pH 7.5)

  • Add luciferase assay reagents to detect ATP production

  • Initiate ATP synthesis by creating proton gradient (e.g., with valinomycin)

  • Measure luminescence as indicator of functional complex assembly

Structural Approaches

Cryo-electron microscopy (Cryo-EM) visualizes intact complexes:

  • Resolves structures of entire ATP synthase assemblies

  • Visualizes different conformational states

  • Does not require crystallization

  • Search result #6 describes cryo-EM structures of related ATP synthase complexes

This multi-faceted experimental strategy provides comprehensive insights into both the structural and functional aspects of subunit b/b' interactions within the ATP synthase complex.

How can site-directed mutagenesis of Methylobacterium sp. ATP synthase subunit b/b' (atpG) reveal functional mechanisms?

Site-directed mutagenesis provides powerful insights into structure-function relationships of ATP synthase components. A strategic approach to investigating Methylobacterium sp. ATP synthase subunit b/b' includes:

Rational Selection of Mutagenesis Targets

Sequence analysis guides strategic mutation design:

  • Multiple sequence alignment identifies conserved residues across bacterial species

  • Structural prediction identifies residues at interfaces with other subunits

  • Literature-based targeting focuses on regions with known functional importance

  • Analysis of homologous proteins provides comparative insights

Strategic Mutation Categories

Different mutation types provide complementary functional insights:

Conservative substitutions maintain chemical properties:

  • Replace residues with similar ones (e.g., Asp to Glu)

  • Test specificity requirements while maintaining structural integrity

  • Identify positions where exact chemical properties are essential

Non-conservative substitutions test fundamental hypotheses:

  • Dramatically alter residue properties (e.g., charged to hydrophobic)

  • Examine electrostatic interactions or hydrophobic packing

  • Reveal critical chemical requirements at specific positions

Alanine scanning systematically maps functional surfaces:

  • Systematically replace residues with alanine

  • Removes side chain interactions while maintaining backbone structure

  • Identifies residues that contribute significantly to function

  • Creates comprehensive functional maps of protein surfaces

Deletion mutations interrogate domain functions:

  • Remove portions of the protein to test domain contributions

  • Particularly valuable for terminal regions or loops

  • Similar to studies showing deletion of C-terminal domain of subunit α affects ATP hydrolysis in mycobacteria

Comprehensive Experimental Design

RegionTarget ResiduesMutation TypeFunctional HypothesisAssay Method
N-terminal transmembraneHydrophobic residuesConservative (Leu→Ile)Affect membrane anchoringMembrane association assays
Dimerization domainCharged residuesCharge reversalDisrupt b-b' interactionOligomerization assays
F₁-interaction domainConserved residuesAlanine substitutionAffect interaction with α/δPull-down assays, ATP synthesis
Hinge regionsProline/glycine residuesRigid amino acid substitutionAlter flexibilityStructural studies, activity assays

Functional Assessment Methodology

ATP synthesis/hydrolysis assays provide direct functional readouts:

  • Reconstitute mutant proteins into liposomes

  • Measure ATP synthesis using luciferase assays as described in literature

  • Compare activities of wild-type and mutant proteins

  • Quantify both synthesis and hydrolysis rates to assess bidirectional effects

Binding assays evaluate interaction consequences:

  • Measure interaction with other ATP synthase subunits

  • Use SPR, pull-down assays, or other interaction methods

  • Quantify binding affinity changes resulting from mutations

A case study from the literature demonstrates the power of this approach: deletion of the C-terminal domain of subunit α in Mycobacterium sp. ATP synthase enhanced ATPase activity by 32-fold while reducing ATP synthesis . Similar strategic mutations in the b/b' subunit would likely reveal its role in regulating ATP synthesis/hydrolysis balance in Methylobacterium sp.

How does Methylobacterium sp. ATP synthase subunit b/b' (atpG) contribute to environmental adaptation?

Methylobacterium species demonstrate remarkable environmental adaptability, and the ATP synthase complex, including subunit b/b' (atpG), plays crucial roles in these adaptive responses:

Adaptation to Methylotrophic Metabolism

Methylobacterium species can grow on single-carbon compounds like methanol, requiring specialized energy conservation mechanisms:

  • ATP synthase couples proton motive force generated during methanol oxidation to ATP synthesis

  • The structure of subunit b/b' likely optimizes energy coupling efficiency during methylotrophic growth

  • Expression levels of ATP synthase components may be regulated in response to carbon source availability

  • Methylobacterium strains adjust cytokinin production based on methanol availability, suggesting metabolic regulation of energy production

Stress Response Mechanisms

Temperature tolerance mechanisms involve ATP synthase components:

  • Methylobacterium species demonstrate remarkable survival at high temperatures (50-60°C)

  • At 60°C, survival rates range from 2% to 85%, substantially higher than E. coli controls

  • Extended exposure (6 minutes) at 60°C reduces survival to 8% for M. adhaesivum

  • ATP synthase must remain functional under these temperature extremes, suggesting thermostable adaptations

pH response involves modulation of ATP synthase expression:

  • Proteomic analysis reveals increased abundance of ATP synthase subunits at pH 6.0

  • This suggests ATP synthase component regulation is part of pH adaptation response

  • The b/b' subunit likely contributes to maintaining ATP synthesis efficiency across pH ranges

  • Different Methylobacterium species show distinct proteomic responses to environmental pH

Biofilm Formation and Surface Colonization

Methylobacterium species demonstrate specific surface interaction characteristics:

  • High cell-surface hydrophobicity facilitates adherence to various surfaces

  • Contact angle measurements on different surfaces reveal strong adherence properties

  • Highest contact angles measured on PVC and galvanized surfaces, with lower values on glass

  • ATP synthase function must be maintained under the metabolic constraints of biofilm growth

Symbiotic Relationships with Plants

Methylobacterium strains function as plant growth-promoting bacteria:

  • Synthesize unusually high levels of plant hormones, including cytokinins

  • Production ranges from 5.09 to 191.47 pmol/mL for total cytokinins

  • Trans-zeatin production varies from 0.46 to 82.16 pmol/mL depending on strain

  • Energy metabolism supporting these biosynthetic processes relies on efficient ATP synthase function

These diverse adaptive capabilities highlight the importance of optimized ATP synthase function, with the b/b' subunit serving as a critical component in maintaining energy homeostasis across varying environmental conditions.

What methods enable incorporation of recombinant Methylobacterium sp. ATP synthase subunit b/b' (atpG) into liposomes for bioenergetic studies?

Reconstitution of recombinant ATP synthase components into liposomes creates functional model systems for bioenergetic studies. Based on established methodologies, the following approaches are recommended for Methylobacterium sp. ATP synthase subunit b/b':

Liposome Preparation Methodology

Phospholipid selection and preparation:

  • Phosphatidylcholine from soybean is commonly used for bacterial ATP synthase reconstitution

  • Small unilamellar vesicles are generated through sonication, extrusion, or detergent dialysis

  • Liposome size control (100-200 nm diameter) mimics bacterial membrane curvature

  • Lipid composition can be adjusted to match native Methylobacterium membrane characteristics

Reconstitution Approaches

For individual subunit membrane association studies:

  • Direct incorporation mixes purified b/b' subunit with preformed liposomes

  • Spontaneous insertion of the transmembrane domain occurs during incubation

  • This approach is optimal for studying membrane association of individual subunits

  • Orientation can be assessed using protease accessibility assays

For complete ATP synthase functional studies:

  • Detergent-mediated reconstitution combines purified components with phospholipids

  • ATP synthase components (including b/b') are solubilized in mild detergent

  • Detergent removal occurs slowly through dialysis or Bio-Beads adsorption

  • This approach creates functional proteoliposomes capable of ATP synthesis

Verification of Successful Reconstitution

Multiple analytical methods confirm proper incorporation:

  • Protein:lipid ratio determination through protein and phospholipid assays

  • Sucrose density gradient centrifugation confirms integration by floating behavior

  • Freeze-fracture electron microscopy visualizes protein distribution

  • Dynamic light scattering assesses size distribution and homogeneity

Functional Assay Protocol

Based on established methodology :

  • Prepare proteoliposomes containing reconstituted ATP synthase components

  • Collect by centrifugation (150,000× g, 30 min)

  • Resuspend in ATP synthesis buffer (e.g., 100 mM Tris, 100 mM maleic acid, 5 mM MgCl₂, 150 mM NaCl, 200 mM KCl, 5 mM KH₂PO₄, pH 7.5)

  • Set up measurement in white flat-bottomed 96-well plates

  • Mix 375 µL proteoliposomes with ATP detection reagent (luciferase assay)

  • Establish baseline (3 min, 37°C)

  • Initiate ATP synthesis by adding valinomycin (2 µM) to induce membrane potential and ADP (5 mM)

  • Monitor luminescence continuously as measure of ATP synthesis

  • For inhibitor studies, preincubate proteoliposomes with test compounds before measurement

This methodology provides a comprehensive approach to studying Methylobacterium sp. ATP synthase subunit b/b' function in a membrane environment that closely mimics its native context.

What challenges exist in crystallizing Methylobacterium sp. ATP synthase subunit b/b' (atpG), and how can they be addressed?

Crystallizing membrane proteins like ATP synthase subunit b/b' presents significant technical challenges. Understanding these challenges and implementing strategic approaches increases the likelihood of success:

Major Crystallization Challenges

Protein production limitations:

  • Membrane proteins often express poorly in heterologous systems

  • Hydrophobic transmembrane domains can cause aggregation during expression and purification

  • Obtaining sufficient quantities of pure, homogeneous protein is difficult

Structural characteristics complicating crystallization:

  • The b/b' subunit likely possesses significant flexibility in its extended portions

  • Flexible regions prevent regular crystal packing arrangements

  • The elongated shape of b/b' creates unfavorable geometry for crystal formation

Detergent considerations:

  • Appropriate detergents must solubilize the membrane-spanning region

  • Detergent micelles can interfere with crystal contacts

  • Finding optimal detergent conditions is largely empirical and time-consuming

Strategic Protein Engineering Solutions

Truncation constructs focus crystallization efforts:

  • Design constructs targeting specific domains (e.g., cytoplasmic domain)

  • Remove flexible regions that hinder crystallization

  • Create stable, well-folded fragments with improved crystallization properties

Fusion protein approaches enhance crystallizability:

  • Add crystallization chaperones (T4 lysozyme, BRIL, etc.)

  • These provide additional crystal contacts

  • Common fusion points include terminal regions or replacing flexible loops

Surface entropy reduction improves crystal packing:

  • Identify surface patches with high conformational entropy

  • Mutate clusters of high-entropy residues (Lys, Glu, Gln) to alanine

  • Creates surface patches more conducive to crystal formation

Advanced Crystallization Methodologies

Lipidic cubic phase (LCP) crystallization:

  • Creates lipid bilayer environment mimicking natural membrane

  • Has succeeded with numerous challenging membrane proteins

  • May stabilize transmembrane region of b/b' in native-like conformation

Bicelle crystallization technique:

  • Uses mixture of long-chain and short-chain phospholipids

  • Creates disc-like environment for membrane proteins

  • Reduces detergent micelle size that can interfere with crystal contacts

Antibody fragment co-crystallization:

  • Utilizes Fab or nanobody fragments binding specifically to b/b'

  • Provides additional hydrophilic surfaces for crystal contacts

  • Can stabilize flexible regions, locking protein in specific conformation

Alternative Structural Approaches

Cryo-electron microscopy (Cryo-EM) circumvents crystallization:

  • Does not require protein crystals

  • Resolves structures at near-atomic resolution

  • Particularly suitable for larger complexes like entire ATP synthase

  • Recent studies have successfully used cryo-EM for ATP synthase structural analysis

Nuclear magnetic resonance (NMR) spectroscopy for specific domains:

  • Suitable for individual domains or smaller fragments

  • Provides dynamic information unavailable from static structures

  • Complements crystallographic approaches for flexible regions

Practical Implementation Strategy

Based on successful approaches with related proteins, a strategic workflow would include:

  • Initial crystallization screening with commercial membrane protein-optimized screens

  • Quality control assessments:

    • Size-exclusion chromatography to verify homogeneity

    • Dynamic light scattering to monitor stability over time

  • For unsuccessful initial screens:

    • Generate library of constructs with various truncations/fusions

    • Screen multiple detergents using thermal stability assays

  • For promising conditions yielding microcrystals:

    • Optimize using grid screens around initial conditions

    • Apply seeding techniques to improve crystal size and quality

  • If crystallization proves extremely challenging:

    • Pivot to cryo-EM studies of entire ATP synthase complex

This comprehensive approach addresses the specific challenges of crystallizing Methylobacterium sp. ATP synthase subunit b/b' while providing alternative strategies when crystallization proves difficult.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.