Recombinant Methylobacterium sp. Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
lspA; M446_2219; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Methylobacterium sp. (strain 4-46)
Target Names
lspA
Target Protein Sequence
MRPLILGLATAAATLVLDQATKLGLLLLADLPARQPVVLAPFAQLVVVWNRGVSYGLFQQ HTELGRWLLVGVAVLAAAALGAWMARAGSRLLVLSLGLIVGGAVGNAVDRVAYGAVFDFV HLHAGGWSWYVFNVADAGIVAGVAGLLVETVWSEARGDAAMRPDG
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (lspA) in Methylobacterium sp.?

Lipoprotein signal peptidase (lspA) in Methylobacterium species is a membrane-bound enzyme responsible for cleaving the signal peptide sequences of lipoproteins following their lipidation by lipoprotein diacylglyceryl transferase (Lgt). Based on homology with characterized bacterial lspA proteins, Methylobacterium lspA likely belongs to the aspartic peptidase family, featuring a catalytic dyad of conserved aspartic acid residues. The enzyme plays a crucial role in the maturation pathway of bacterial lipoproteins, which are important for nutrient acquisition, cell envelope integrity, and potentially plant-microbe interactions that are particularly relevant for Methylobacterium species .

What is the relationship between lspA and bacterial virulence?

While Methylobacterium species are not typically considered pathogens, studies in pathogenic bacteria provide insights into lspA's potential importance. In Mycobacterium tuberculosis, disruption of lspA does not affect in vitro growth but markedly attenuates virulence in infection models, establishing lipoprotein metabolism as a major virulence determinant . This suggests that in Methylobacterium, lspA may be similarly crucial for environmental fitness and plant-microbe interactions, even if not directly linked to pathogenesis. The proper processing of lipoproteins by lspA likely ensures correct localization and function of proteins involved in nutrient acquisition and stress responses that contribute to bacterial survival in natural habitats .

What are key considerations when designing a gene knockout strategy for lspA in Methylobacterium?

When designing a knockout strategy for lspA in Methylobacterium, researchers should consider:

  • Essentiality assessment: While lspA may be dispensable for in vitro growth in rich media (as observed in M. tuberculosis), it could be essential under specific environmental conditions . Preliminary experiments using conditional knockdowns can help determine essentiality.

  • Precise deletion approach: To avoid polar effects on adjacent genes, implement a precise deletion strategy using homologous recombination with constructs containing upstream and downstream flanking regions of lspA .

  • Complementation system: Establish a complementation system concurrently using an integrative or stable plasmid carrying the wild-type lspA gene under a controllable promoter to confirm phenotype specificity.

  • Validation methods: Employ multiple approaches to confirm deletion, including PCR verification, RNA-seq, and proteomic analysis to check for absence of lspA transcript and protein, as well as effects on lipoprotein processing .

  • Control strains: Include appropriate control strains, such as those carrying deletions of non-essential genes with similar expression patterns to distinguish specific effects of lspA deletion from general effects of genetic manipulation .

How can CRISPRi be optimized for studying essential functions of lspA?

CRISPRi optimization for studying lspA functions involves:

Optimization ParameterRecommendationRationale
Guide RNA designTarget multiple sites within lspA geneIdentifies optimal knockdown efficiency
dCas9 expressionUse tetracycline-inducible systemAllows titration of knockdown levels
ValidationqRT-PCR and Western blottingConfirms knockdown efficiency
ControlsInclude non-targeting gRNADistinguishes specific from non-specific effects
Phenotypic timingAnalyze at defined intervals post-inductionCaptures direct effects before secondary consequences

A robust approach would utilize the established CRISPRi methodology similar to that developed for mycobacterial systems, which includes a set of validated vectors specifically targeting essential core genes . For Methylobacterium, adapting these tools would require optimizing promoter elements and guide RNA design based on genome sequence analysis of the target strain .

What experimental approaches can link lspA activity to specific cellular phenotypes?

To establish causal relationships between lspA activity and specific cellular phenotypes:

  • Lipoprotein processing analysis: Compare processing of model lipoproteins (e.g., MtuA homologs) in wild-type and lspA-depleted strains using Western blotting to detect size differences between processed and unprocessed forms .

  • Globomycin inhibition studies: Use the specific lspA inhibitor globomycin at varying concentrations to create a gradient of lspA inhibition and correlate inhibition levels with phenotypic outcomes .

  • Membrane proteomics: Apply quantitative proteomics to compare membrane protein composition between wild-type and lspA-depleted conditions, focusing on accumulation of signal peptide-containing lipoproteins .

  • Conditional depletion time-course: Implement tightly controlled depletion systems and monitor phenotypic changes over time to distinguish primary from secondary effects of lspA depletion .

  • Alternative processing analysis: Investigate potential compensatory processing by other peptidases (such as Eep homologs) when lspA is absent, similar to observations in Streptococcus uberis .

What expression systems are optimal for producing recombinant Methylobacterium lspA?

For recombinant expression of Methylobacterium lspA, consider these systems:

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coli BL21(DE3) derivativesRapid growth, high yieldPotential membrane protein folding issues16-20°C induction, membrane-mimicking agents
Mycobacterium smegmatis mc²155Similar membrane environmentLower yield, slower growth30°C growth, acetamide-inducible system
Methylobacterium hostNative environment, proper processingLimited genetic toolsHomologous recombination, native promoter
Cell-free systemsAvoids toxicity issuesExpensive, requires optimizationSupplementation with lipids and detergents

When expressing membrane proteins like lspA, include a purification tag that doesn't interfere with the transmembrane domains (typically four in lspA proteins). C-terminal tags are generally preferred as N-terminal tags may interfere with membrane insertion. For functional studies, maintain the enzyme in a membrane-like environment using appropriate detergents .

How can the enzymatic activity of recombinant lspA be assayed in vitro?

Several complementary approaches can be used to assay lspA activity:

  • Western blot detection: Monitor the conversion of pre-lipoproteins to mature forms using antibodies specific to a model lipoprotein such as MtuA. In functional assays, wild-type lspA should produce a band approximately 2 kDa smaller than the precursor form representing the cleaved signal peptide .

  • Globomycin inhibition: Include control reactions with globomycin, a specific inhibitor of lspA. Effective inhibition should prevent signal peptide cleavage, resulting in retention of the higher molecular weight precursor form .

  • Mass spectrometry: Analyze processed and unprocessed forms of substrate lipoproteins to precisely identify the cleavage site and efficiency of processing.

  • Fluorogenic peptide substrates: Develop FRET-based substrates containing the lipobox motif (LxxC) to enable real-time monitoring of cleavage activity.

For optimal results, reconstitute purified lspA in proteoliposomes or detergent micelles, add pre-lipidated substrate (treated with Lgt), and monitor signal peptide cleavage over time .

What purification strategies work best for Methylobacterium lspA?

Purifying membrane-embedded lspA requires specialized approaches:

  • Membrane extraction: Solubilize membranes using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that maintain protein structure while effectively extracting membrane proteins.

  • Affinity chromatography: Use His-tagged or other affinity-tagged constructs for initial purification, with detergent present throughout all buffers.

  • Size exclusion chromatography: Apply as a polishing step to separate properly folded protein from aggregates and ensure homogeneity.

  • Activity validation: Test each purification fraction for lspA activity using the processing of a model substrate to identify active fractions.

  • Reconstitution: For long-term stability and activity studies, reconstitute purified lspA into nanodiscs or liposomes composed of lipids similar to Methylobacterium membranes.

Throughout purification, maintain conditions that preserve the aspartic peptidase activity, including appropriate pH (typically 6.0-7.5) and protection from proteolytic degradation .

How do you interpret conflicting results in lspA activity assays?

When facing conflicting results in lspA activity assays:

  • Substrate specificity assessment: Different lipoprotein substrates may be processed with varying efficiencies. Test multiple substrates, including native Methylobacterium lipoproteins.

  • Alternative processing pathways: Consider the possibility of alternative processing by other peptidases such as Eep homologs, which could explain partial processing observed in lspA-deficient conditions .

  • Growth phase effects: In Streptococcus uberis, different lipoprotein processing patterns were observed depending on growth phase. Similar temporal regulation might occur in Methylobacterium, requiring careful timing of experiments .

  • Inhibitor specificity: When using inhibitors like globomycin, verify their efficacy in your specific system, as concentrations effective for other bacteria may differ for Methylobacterium .

  • Membrane environment effects: lspA activity is sensitive to membrane composition and properties. Variations in expression conditions that affect membrane composition can lead to inconsistent activity results.

  • Statistical approach: Apply appropriate statistical tests that account for nested sources of variation in the experimental design, and ensure sufficient biological replicates to distinguish real effects from experimental noise.

What controls are essential when studying recombinant lspA activity?

Essential controls for recombinant lspA activity studies include:

  • Catalytic site mutants: Mutating the conserved aspartic acid residues that form the catalytic dyad should abolish activity, providing a negative control .

  • Globomycin inhibition: Include reactions with globomycin, which specifically inhibits lspA activity. This confirms that observed processing is due to lspA rather than other peptidases .

  • Growth phase controls: When analyzing lipoprotein processing in vivo, sample at multiple growth phases, as processing patterns may change through the growth curve .

  • Substrate prerequisites: Verify that substrates have been properly lipidated by Lgt, as this modification is typically required before lspA can efficiently cleave the signal peptide .

  • Double mutant controls: When investigating alternative processing pathways, include double mutants (e.g., lspA/eep) to confirm the involvement of specific alternative peptidases .

  • Membrane fraction controls: Include proper fractionation controls to ensure the observed proteins are correctly localized to appropriate cellular compartments .

How do you differentiate between direct and indirect effects of lspA mutation?

Distinguishing direct from indirect effects of lspA mutation requires:

  • Temporal analysis: Implement time-course experiments following lspA depletion or inhibition. Direct effects typically manifest rapidly, while indirect consequences appear progressively later.

  • Complementation studies: Express wild-type lspA in the mutant background—direct effects should be fully reversed, while indirect effects may show partial or delayed restoration.

  • Specific substrate analysis: Focus on known lspA substrates and their processing status. Direct effects include accumulation of unprocessed forms of specific lipoproteins.

  • Pathway-specific markers: Monitor markers of membrane stress, envelope integrity, and other pathways potentially affected by improper lipoprotein processing to differentiate primary (direct) from secondary (indirect) effects.

  • Quantitative proteomics: Compare proteome changes at multiple time points after lspA depletion to identify the earliest affected proteins, which are more likely to be direct targets .

How does the structure of Methylobacterium lspA compare to homologs in other bacterial species?

Structural analysis of Methylobacterium lspA based on homology with characterized bacterial signal peptidases suggests:

  • Membrane topology: Likely contains four transmembrane-spanning regions, with both the N- and C-termini located on the same side of the cytoplasmic membrane .

  • Catalytic mechanism: Functions as an aspartic peptidase with two strictly conserved aspartic acid residues (likely Asp-102 and Asp-129 based on B. subtilis numbering) that act as a catalytic dyad .

  • Active site location: The catalytic residues are predicted to be localized close to the external surface of the cytoplasmic membrane, allowing access to lipoprotein substrates following their lipidation by Lgt .

  • Conserved regions: Contains five regions of sequence conservation identified in bacterial Lsp enzymes, with residues important for both catalytic activity and structural stability .

  • Inhibitor binding: The binding site for globomycin likely involves residues in the transmembrane regions and active site pocket, as this antibiotic is a potent, reversible, noncompetitive inhibitor of Lsp enzymes .

Experimental approaches to validate these predictions could include site-directed mutagenesis of predicted catalytic residues, membrane topology mapping using reporter fusions, and inhibitor binding studies.

What role might lspA play in Methylobacterium-plant interactions?

The role of lspA in Methylobacterium-plant interactions may include:

  • Processing of plant-interaction lipoproteins: Methylobacterium species form beneficial associations with plants, and properly processed lipoproteins may be essential for these interactions, similar to how lspA is required for full virulence in pathogenic bacteria .

  • Nutrient acquisition: Methylobacterium species can metabolize plant-derived compounds like methanol. Many nutrient transporters are lipoproteins requiring proper processing by lspA for function .

  • Environmental stress adaptation: Plant surfaces represent fluctuating microenvironments. Properly processed lipoproteins contribute to stress resistance mechanisms needed for successful plant colonization .

  • Plant growth promotion: Methylobacterium can enhance plant growth through various mechanisms. The ability to properly process lipoproteins involved in these beneficial interactions likely depends on functional lspA .

  • Community interactions: In environmental samples, Methylobacterium has been co-isolated with other bacteria like Mycobacterium species. Proper lipoprotein processing may influence these microbial community dynamics on plant surfaces .

Experimental approaches to investigate these roles should compare wild-type and lspA-depleted Methylobacterium strains for plant colonization efficiency, methanol utilization, and effects on plant growth.

How does inhibition of lspA affect Methylobacterium growth and survival?

Inhibition of lspA in Methylobacterium likely affects growth and survival in several ways:

  • Conditional essentiality: Based on studies in M. tuberculosis, lspA may be dispensable for in vitro growth in rich media but essential under specific conditions relevant to its ecological niche .

  • Accumulation of unprocessed lipoproteins: Inhibition would lead to accumulation of signal peptide-containing lipoproteins, potentially disrupting membrane integrity and function as observed with globomycin treatment .

  • Alternative processing: As observed in Streptococcus uberis, alternative peptidases (e.g., Eep homologs) might partially compensate for lspA loss, leading to atypical processing of some lipoproteins rather than complete absence of processing .

  • Growth phase effects: The impact of lspA inhibition may vary depending on growth phase, with more pronounced effects during late logarithmic or stationary phase when membrane remodeling processes are active .

  • Environmental fitness: While in vitro growth in laboratory media might show minimal effects, environmental fitness and competitive ability are likely significantly compromised when lspA is inhibited, similar to the attenuation observed in M. tuberculosis infection models .

Experimental investigation should include both chemical inhibition with globomycin at various concentrations and genetic depletion approaches, coupled with comprehensive phenotypic characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.