Recombinant Methylobacterium sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; M446_5081; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-624
Protein Length
full length protein
Species
Methylobacterium sp. (strain 4-46)
Target Names
yidC
Target Protein Sequence
MGNDKTNMIIAIALSLAVLLGWNYFVTAPQVERQRQQQAAQVNPSQGVNPSQGVDPSQGV NASPSPKEGGPSAPVPGTLPGAAGGSPQAALARDEALARAPRVRIDTEALRGSVALKGGR IDDVALKGYHETVDPKSPEIVLLSPAGSANPYYAEFGWVGQNAGPLPGSDTVWTADGDVL TAKKPLVLTFDNGAGLVFRRTLSVDDKYMFTIEDSVENKGPNPVTLYPYGLVSRWGKPHT QGYYVLHEGMIGVVGDKGLQEYTYDKMAKENPLGAPGTRGVSWPGATGGFLGITDKYWAA ATIPDQQAPYTGSFTERDEGATKVYQASSLGEARAVAPGASVQASQRLFAGAKEVSTVDA YREKLNIKQFDLLIDWGWFYFITKPMFKALDLFYKLFGNFGVSILVVTLILKLFFLPIAN RSYVSMAKMKAVQPEMTAIRERYADDKVKQQQAMMELYKKEKINPVAGCWPVLIQIPVFF SLYKVLFVTIEMRHAPFFGWIRDLAAPDPTSIVNLFGLLPFTPPDLLHLGVWPIVMGITM FLQMKMNPAPPDPVQAQVFTFMPIIFTFMLGSFPAGLVIYWAWNNLLSILQQYWIMRRNG VKVELWDNLRSTFQRRTQVKTAKG
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of YidC in bacterial membrane protein biogenesis?

YidC belongs to the YidC/Oxa1/Alb3 protein family involved in membrane protein biogenesis across bacteria, mitochondria, and chloroplasts. It functions as a membrane protein insertase that facilitates the integration of specific proteins into cellular membranes. Recent studies have demonstrated that YidC can insert certain membrane proteins using a channel-independent mechanism, distinguishing it from other insertion pathways . In Methylobacterium sp., as in other bacteria, YidC likely plays a crucial role in respiratory metabolism and proper membrane protein folding and assembly.

How is YidC typically organized genomically in bacteria?

In many bacterial species, the yidC gene is expressed as part of an operon with upstream genes, suggesting coordinated expression with functionally related proteins . Some bacterial species, like Bacillus subtilis, contain two YidC homologs (SpoIIIJ/YidC1 and YidC2/YqjG), where one is constitutively expressed while the other is induced under specific conditions . For Methylobacterium sp., genomic analysis would be required to determine if it possesses single or multiple YidC homologs and their genomic organization.

What experimental systems are available for studying YidC function?

Several experimental approaches can be used to study YidC in Methylobacterium sp.:

  • Gene deletion studies using allelic exchange with antibiotic resistance markers

  • Controlled expression systems using inducible promoters (e.g., anhydrotetracycline-inducible promoters)

  • Creation of chimeric proteins to study domain-specific functions

  • Site-directed mutagenesis to investigate critical residues

  • Protein localization studies using antibody detection or fluorescent protein fusions

These approaches have been successfully applied in other bacterial species such as M. tuberculosis and B. subtilis .

How does YidC expression respond to different cellular stresses?

YidC expression shows complex responses to cellular stresses. In M. tuberculosis, an interesting paradox exists between YidC protein levels and mRNA transcripts under stress conditions. While the protein level moderately increases during cell surface stresses, the corresponding mRNA transcript levels are significantly repressed . This suggests sophisticated post-transcriptional regulation mechanisms. For Methylobacterium sp. research, monitoring both mRNA and protein levels under various stresses would be essential for understanding YidC regulation.

What are the optimal methods for controlled expression of YidC in Methylobacterium sp.?

For controlled expression studies in Methylobacterium sp., researchers should consider:

  • Selection of appropriate inducible promoter systems (such as ATc-inducible promoters used in M. tuberculosis studies)

  • Use of replicative plasmids with different copy numbers to achieve varied expression levels

  • Careful titration of inducer concentrations to achieve desired expression levels

  • Monitoring expression at both transcript and protein levels using qRT-PCR and Western blotting with monospecific antibodies

  • Inclusion of appropriate controls, such as expression of alternative genes under the same promoter

When overexpressing YidC in M. tuberculosis, researchers observed that the induction of YidC protein could be achieved using an ATc-inducible promoter, with transcript levels increasing in a dose-dependent manner in response to different concentrations of ATc .

How can the structural and functional domains of YidC be characterized in Methylobacterium sp.?

Characterization of YidC domains can be approached through:

  • Creation of chimeric constructs where domains are swapped between different YidC homologs

  • Site-directed mutagenesis of key residues predicted to be important for function

  • 3D-structure prediction tools to evaluate structural constraints

  • Analysis of phenotypic effects of domain modifications under various stress conditions

In S. mutans, researchers engineered chimeric YidC1/YidC2 constructs to identify the functional importance of cytoplasmic domains. They discovered that YidC1 showed considerable plasticity and could accommodate various cytoplasmic domain substitutions without significant impact on function, while YidC2 was less malleable and required specific domain combinations to support growth under stress conditions .

What approaches can be used to identify YidC interaction partners in Methylobacterium sp.?

To identify YidC interaction partners:

  • Co-immunoprecipitation with YidC-specific antibodies

  • Bacterial two-hybrid assays for detecting protein-protein interactions

  • Crosslinking experiments followed by mass spectrometry

  • Pull-down assays with tagged YidC variants

  • In situ proximity labeling approaches

These methods can reveal interactions with substrate proteins, other components of the protein translocation machinery, or potential regulatory proteins specific to Methylobacterium sp.

How can YidC depletion systems be engineered in Methylobacterium sp.?

Creating effective YidC depletion systems requires:

  • Construction of conditional expression strains where the native yidC gene is deleted and replaced with an inducible copy

  • Design of regulatory systems that allow tight control of YidC expression

  • Verification of depletion at both mRNA and protein levels

  • Monitoring physiological parameters during depletion

Previous research in M. tuberculosis has established that YidC depletion is deleterious for both extra- and intracellular bacterial proliferation , highlighting the importance of carefully regulated depletion systems.

What are the challenges in distinguishing YidC-dependent from Sec-dependent membrane protein insertion?

Distinguishing these pathways requires:

  • Creation of substrate protein libraries with systematic variations

  • Development of in vivo and in vitro insertion assays specific to each pathway

  • Use of specific inhibitors or mutations that selectively affect each pathway

  • Analysis of substrate requirements for each pathway

Evolutionary analysis suggests a potential common origin for SecY and YidC, with evidence that SecY may have evolved from a dimeric YidC homologue by gene duplication and fusion . This evolutionary relationship complicates the distinction between pathways but also provides insight into their mechanistic similarities and differences.

How can variations in YidC expression levels be accurately quantified?

Accurate quantification methods include:

  • Absolute quantification of mRNA using standard curves in qRT-PCR

  • Protein quantification using calibrated Western blotting

  • Ribosome profiling to assess translation efficiency

  • Reporter gene fusions (e.g., lacZ fusions) for promoter activity measurement

In B. subtilis, researchers used lacZ translational-fusion genes (mifM-yidC2′-lacZ) to measure YidC2 induction levels under various conditions . Similar approaches could be adapted for Methylobacterium sp.

How should conflicting data between mRNA and protein levels be interpreted?

When facing discrepancies between mRNA and protein levels:

  • Consider post-transcriptional regulatory mechanisms

  • Evaluate mRNA stability and half-life

  • Assess translation efficiency and potential translation arrest mechanisms

  • Examine protein stability and degradation rates

  • Investigate potential feedback loops

Such discrepancies have been observed in M. tuberculosis, where YidC protein levels increased moderately under cell surface stresses while mRNA transcript levels were significantly repressed . This highlights the importance of analyzing both transcriptional and post-transcriptional regulatory mechanisms.

What statistical approaches are most appropriate for analyzing YidC phenotypic data?

For robust statistical analysis:

  • Use appropriate replicates (biological and technical)

  • Apply parametric or non-parametric tests based on data distribution

  • Consider multiple testing corrections for large-scale experiments

  • Use multivariate analysis for complex phenotypic data

  • Employ growth curve analysis for time-dependent phenotypes

When analyzing phenotypic effects of YidC chimeric variants in S. mutans, researchers examined multiple stress conditions including acid, osmotic, and metal excess to comprehensively characterize functional impacts .

How can evolutionary relationships between YidC homologs be leveraged for functional studies?

Evolutionary insights can guide research through:

  • Identification of conserved residues across species for targeted mutagenesis

  • Analysis of co-evolution patterns to predict interaction partners

  • Comparing functional differences between paralogs in species with multiple YidC homologs

  • Reconstruction of ancestral sequences to study evolutionary trajectories

Structural analysis has revealed surprising similarities between SecY and YidC, suggesting that SecY evolved from a dimeric YidC homologue through gene duplication and fusion . This evolutionary relationship provides valuable insights for comparative functional studies.

What can be learned from comparing YidC from Methylobacterium sp. with homologs from other bacterial species?

Comparative analyses can reveal:

  • Methylobacterium-specific adaptations in YidC structure and function

  • Conservation of critical functional residues

  • Lineage-specific regulatory mechanisms

  • Potential specialized functions in different bacterial contexts

For example, comparing M. tuberculosis YidC with M. smegmatis YidC (which share 75% identity) revealed species-specific physiological impacts of YidC overexpression . Similar comparative approaches with Methylobacterium sp. YidC could provide insights into its specialized functions.

How are YidC expression levels controlled in bacteria?

YidC expression is regulated through:

  • Transcriptional control mechanisms

  • Post-transcriptional regulatory elements

  • Translation arrest mechanisms

  • Feedback regulation systems

In B. subtilis, YidC2 expression is regulated by the translation arrest of an upstream open reading frame, MifM. The MifM peptide monitors total YidC activity in the cell and regulates YidC2 expression accordingly through a sophisticated feedback mechanism .

What methods can detect translational regulation of YidC expression?

To investigate translational regulation:

  • Ribosome profiling to map translation efficiency across mRNAs

  • Reporter gene fusions with potential regulatory elements

  • Analysis of mRNA secondary structures that might influence translation

  • In vitro translation assays with purified components

B. subtilis utilizes a regulatory system where MifM undergoes regulated translation arrest, which affects a stem-loop secondary structure in the mRNA that normally sequesters the Shine-Dalgarno sequence of yidC2. When arrested, the stalled ribosome prevents this stem-loop formation, exposing the SD sequence and enabling yidC2 translation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.