Recombinant Methylobacterium sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributors for specific delivery timelines.
Please note that all our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate your request in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us and we will prioritize development of the specified tag.
Synonyms
nuoK; M446_4400; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Methylobacterium sp. (strain 4-46)
Target Names
nuoK
Target Protein Sequence
MIGLSHYLTVAAILFTLGVLGIFINRKNVIVILMCVELILLAVNINLVAFSTHLGDIVGQ VFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. Consequently, the redox energy is conserved in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase and what role does it play in Methylobacterium metabolism?

NADH-quinone oxidoreductase (NDH-1, also called Complex I) is a key component of the respiratory chain in aerobic bacteria like Methylobacterium, coupling NADH oxidation to quinone reduction while translocating protons across the membrane. In Methylobacterium, this enzyme functions within the aerobic respiratory pathway, utilizing oxygen as the terminal electron acceptor, which is critical for this obligately aerobic genus . The enzyme catalyzes the reaction: NADH + ubiquinone + 5 H⁺ ↔ NAD⁺ + ubiquinol + 4 H⁺ (periplasm), generating proton motive force used for ATP synthesis . Unlike some other bacteria that may possess specialized sodium-pumping NADH:quinone oxidoreductases, Methylobacterium contains the conventional proton-pumping complex I that is more similar to the enzyme found in Escherichia coli .

What genomic organization typically surrounds the nuoK gene in Methylobacterium species?

In many bacteria, including close relatives of Methylobacterium, the genes encoding NADH-quinone oxidoreductase subunits are typically arranged in an operon structure (the nuo operon). While specific information about the nuoK gene arrangement in Methylobacterium is not directly provided in the search results, we can infer from related alphaproteobacteria that the nuoK gene is likely part of a larger operon containing genes for other NADH-quinone oxidoreductase subunits. This organization facilitates coordinated expression of all components required for the functional complex. Transcriptomic studies in Methylobacterium have detected expression of genes involved in central metabolic pathways including respiratory chain components , suggesting that nuoK would be expressed along with other components of the electron transport chain.

What expression systems are most effective for producing recombinant Methylobacterium nuoK?

For membrane proteins like nuoK, E. coli remains the most widely used expression system due to its rapid growth, high yield potential, and versatility. Based on experiences with similar proteins, several approaches are recommended:

  • E. coli C41(DE3) or C43(DE3) strains: These "Walker strains" are specifically engineered for membrane protein expression and can reduce toxicity issues common with hydrophobic subunits.

  • Controlled expression: Using the lac promoter system with carefully optimized IPTG concentrations (typically 0.1-0.5 mM) and lower temperatures (16-25°C) can improve proper membrane insertion and folding . Similar approaches were successful for expressing other oxidoreductase components as demonstrated with 2-oxoglutarate:ferredoxin oxidoreductase, where active recombinant enzyme was produced in E. coli under the control of the lac promoter .

  • Co-expression strategies: Since nuoK functions as part of a multi-subunit complex, co-expressing it with interacting subunits (particularly adjacent membrane subunits) may improve stability and proper folding.

For verification of expression, Western blotting with antibodies against a tag (typically His6) fused to either the N- or C-terminus of nuoK is recommended, as the small size and hydrophobic nature of nuoK make it difficult to visualize on standard protein gels.

What are the critical considerations for solubilization and purification of recombinant nuoK?

Purifying hydrophobic membrane proteins like nuoK presents significant challenges:

  • Membrane extraction: Carefully optimized detergent solubilization is critical. Initial screening should include:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Intermediate detergents like n-decyl-β-D-maltoside (DM)

    • More aggressive detergents like Triton X-100 (used at lower concentrations)

  • Purification approach: Affinity chromatography using a His-tag is typically the first step, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations.

  • Buffer optimization: Including glycerol (10-20%), appropriate salt concentrations (typically 100-300 mM NaCl), and stabilizing agents can significantly improve stability during purification.

  • Stability assessment: Following purification, circular dichroism spectroscopy should be employed to verify proper folding, and thermal shift assays can identify buffer conditions that maximize stability.

Unlike soluble proteins, nuoK will require detergent in all buffers throughout the purification process to maintain solubility and prevent aggregation. Researchers should expect lower yields compared to soluble proteins due to the challenging nature of membrane protein biochemistry.

How can researchers verify the structural integrity of purified recombinant nuoK?

Verification of structural integrity for recombinant nuoK should employ multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy: This provides information about secondary structure elements and can confirm proper folding. For membrane proteins like nuoK, CD spectra should show patterns characteristic of alpha-helical transmembrane domains.

  • Limited proteolysis: Properly folded membrane proteins show distinct proteolytic patterns compared to misfolded variants.

  • Functional reconstitution: Incorporating purified nuoK into liposomes or nanodiscs with other subunits of the complex can allow assessment of proton pumping activity.

  • Binding assays: If antibodies against the native complex are available, immunoprecipitation or Western blotting can verify structural epitopes.

  • Mass spectrometry: Native or hydrogen-deuterium exchange mass spectrometry can provide insights into structural integrity and interactions with other subunits.

When comparing recombinant nuoK to native protein, researchers should look for similar secondary structure profiles, stability characteristics, and the ability to form proper interactions with other subunits of the NADH-quinone oxidoreductase complex.

What methods are most effective for assessing the enzymatic activity of reconstituted NADH-quinone oxidoreductase containing recombinant nuoK?

Several complementary approaches can be employed to assess the functionality of reconstituted complexes containing recombinant nuoK:

  • NADH oxidation assays: Spectrophotometric monitoring of NADH oxidation at 340 nm provides a direct measure of complex activity. Typical reaction mixtures should contain:

    • 100-200 μM NADH

    • Appropriate ubiquinone analogue (50-100 μM)

    • Buffer (typically 50 mM phosphate or Tris, pH 7.4-8.0)

    • Reconstituted enzyme complex in liposomes or detergent micelles

  • Proton pumping measurements: Since nuoK is involved in proton translocation, measuring pH changes in liposome preparations or using pH-sensitive fluorescent dyes can provide insights into proton pumping activity.

  • Electron transfer kinetics: Stopped-flow spectroscopy can measure the rates of electron transfer between redox centers, which may be affected by mutations or structural perturbations in nuoK.

  • Inhibitor sensitivity profiles: Comparison of inhibition patterns between native and reconstituted complexes using known Complex I inhibitors (rotenone, piericidin A) can verify proper assembly and function.

  • Membrane potential measurements: Using voltage-sensitive dyes to monitor membrane potential generation in proteoliposomes containing the reconstituted complex.

For control experiments, comparisons should be made to: (1) proteoliposomes without reconstituted protein, (2) proteoliposomes with complexes lacking nuoK, and (3) when possible, native complex isolated from Methylobacterium membranes.

How can researchers investigate the proton translocation function of nuoK?

Investigating the proton translocation function of nuoK requires specialized techniques:

  • Site-directed mutagenesis: Conservative and non-conservative mutations of conserved residues within nuoK's predicted proton channel can help identify key residues involved in proton translocation.

  • pH-sensitive fluorescent probes: Reconstituting the complex in liposomes loaded with pH-sensitive fluorescent dyes (ACMA, pyranine) allows real-time monitoring of proton movement across the membrane.

  • Proton/deuterium exchange: Combined with mass spectrometry, this approach can identify residues exposed to the aqueous environment and potentially involved in proton translocation.

  • Patch-clamp electrophysiology: For advanced studies, giant liposome preparations with reconstituted complex can be examined using patch-clamp techniques to directly measure proton currents.

  • Computational modeling: Molecular dynamics simulations can predict proton paths through the nuoK subunit based on structural models derived from homologous proteins.

What approaches can reveal interactions between nuoK and other subunits in the NADH-quinone oxidoreductase complex?

Several techniques can elucidate the interactions between nuoK and other subunits:

  • Cross-linking coupled with mass spectrometry: Chemical cross-linkers can capture transient interactions between subunits, and subsequent mass spectrometry analysis can identify interaction interfaces. This approach has proven valuable for mapping subunit interactions in complex membrane proteins.

  • Co-immunoprecipitation: Using antibodies against tagged versions of nuoK or other subunits can identify stable interaction partners.

  • Two-hybrid membrane protein interaction assays: Modified bacterial or yeast two-hybrid systems designed for membrane proteins can screen for binary interactions between nuoK and other subunits.

  • Genetic suppressor analysis: Introduction of destabilizing mutations in nuoK followed by selection for compensatory mutations in other subunits can identify functionally important interaction surfaces.

  • Cysteine scanning mutagenesis: Introducing cysteine residues at specific positions in nuoK and adjacent subunits, followed by disulfide cross-linking, can map proximity relationships within the assembled complex.

Based on studies of NADH-quinone oxidoreductase from other bacteria, nuoK is expected to interact primarily with other membrane domain subunits (potentially nuoA, nuoJ, nuoH, and nuoN). Establishing these interaction networks is crucial for understanding how electron transfer is coupled to proton translocation in this complex molecular machine.

How does the nuoK subunit from Methylobacterium compare structurally and functionally to homologs in other bacterial species?

The nuoK subunit is evolutionarily conserved across bacterial species, though with variations that can provide insights into species-specific adaptations:

  • Sequence conservation: Comparative sequence analysis typically shows high conservation of transmembrane helices and residues involved in proton translocation. Key residues to examine include charged amino acids (Glu, Asp, Lys, Arg) within the membrane domain that may participate in proton transfer.

  • Structural comparison: While the structure of nuoK from Methylobacterium has not been directly determined, homology modeling based on related structures (such as those from E. coli or Thermus thermophilus) can reveal conservation of key structural elements. For instance, the nuoK homolog in E. coli contains three transmembrane helices that form part of the proton translocation pathway .

  • Functional equivalence: Complementation studies can test whether nuoK from Methylobacterium can functionally replace the equivalent subunit in model organisms like E. coli. Success or failure in such experiments can highlight species-specific functional requirements.

  • Adaptations to metabolic niche: Methylobacterium species are facultative methylotrophs that can grow on single-carbon compounds , which may result in adaptations in their electron transport chain components compared to non-methylotrophic bacteria.

SpeciesnuoK SizeKey Conserved FeaturesUnique Characteristics
E. coli100 aa3 transmembrane helices, conserved charged residuesWell-characterized, standard model for Complex I
Methylobacterium spp.~100 aa (predicted)Predicted similar membrane topologyAdapted to methylotrophic metabolism
Thermus thermophilus98 aaSimilar fold, part of resolved crystal structureThermophilic adaptations
V. choleraeDifferent architectureUses Na⁺-NQR instead of H⁺-pumping Complex ISodium-pumping specificity

This comparative analysis highlights that while NADH-quinone oxidoreductase is widely distributed, there are significant variations in ion specificity (H⁺ vs Na⁺) and potential adaptations to different metabolic lifestyles.

What can we learn from comparing methylotrophic and non-methylotrophic bacteria's respiratory chain complexes?

Comparing respiratory chains between methylotrophic bacteria like Methylobacterium and non-methylotrophic bacteria reveals important adaptations:

  • Electron input sources: Methylotrophs generate NADH through specialized C1 metabolism pathways , potentially requiring adaptations in the NADH-binding domain of their respiratory complexes to accommodate different NADH/NAD⁺ ratios.

  • Energy conservation strategies: Methylobacterium species must efficiently couple methanol oxidation to energy conservation. Their respiratory chain likely contains specific adaptations for optimal energy yield during methylotrophic growth.

  • Metabolic integration: The respiratory chain in Methylobacterium must be integrated with the serine pathway for carbon assimilation during methylotrophic growth , potentially resulting in regulatory or structural differences in respiratory complexes.

  • Oxygen affinity: As obligate aerobes , Methylobacterium species may have respiratory chains optimized for different oxygen concentrations compared to facultative anaerobes like E. coli.

Transcriptomic studies have shown that in Methylobacterium, genes involved in central carbon metabolism pathways and respiratory chain components show coordinated expression patterns during growth on C1 compounds . This suggests specialized regulation of respiratory chain components, including NADH-quinone oxidoreductase, in response to methylotrophic metabolism.

How have NADH-quinone oxidoreductase complexes evolved to support diverse bacterial lifestyles?

The evolution of NADH-quinone oxidoreductase complexes demonstrates remarkable adaptability to different environmental niches:

  • Ion specificity divergence: While most bacteria employ proton-pumping NADH-quinone oxidoreductases (like those in Methylobacterium and E. coli) , some bacteria like Vibrio cholerae have evolved sodium-pumping variants (Na⁺-NQR) . This allows adaptation to different ion gradients and environments.

  • Cofactor diversity: Different bacteria incorporate various cofactors into their respiratory complexes. For example, some contain FMN, FAD, and iron-sulfur clusters in different arrangements , allowing optimization for particular electron transfer requirements.

  • Structural simplification: Some bacteria have evolved simplified versions of NADH-quinone oxidoreductase, particularly those adapting to parasitic lifestyles with reduced metabolic capabilities.

  • Specialized roles: In some species, specialized variants of the complex may function in processes beyond respiration, such as redox balance maintenance or stress responses.

The evolutionary trajectory of these complexes demonstrates how core respiratory machinery has been modified to support diverse bacterial metabolic strategies, from obligate aerobes like Methylobacterium to facultative anaerobes and specialized extremophiles. Understanding these adaptations provides insight into the fundamental principles of bioenergetics and metabolic evolution.

How can recombinant nuoK be used to investigate the mechanism of proton translocation in NADH-quinone oxidoreductase?

Recombinant nuoK provides a powerful tool for dissecting the proton translocation mechanism through several advanced approaches:

  • Structure-guided mutagenesis: Based on homology models or structures of related proteins, researchers can introduce mutations in predicted proton channels or conserved residues in nuoK. Key targets include:

    • Charged residues within transmembrane domains

    • Conserved polar residues that might participate in proton relay networks

    • Residues at interfaces with other membrane subunits

  • Proton pathway mapping: By systematically introducing protonatable amino acids at different positions along potential proton pathways, researchers can track the movement of protons through the membrane domain containing nuoK.

  • Real-time conformational dynamics: Using techniques like single-molecule FRET with fluorescently labeled reconstituted complexes, researchers can observe conformational changes in nuoK during the catalytic cycle, potentially revealing how electron transfer is coupled to proton movement.

  • Heavy hydrogen kinetic isotope effects: Comparing enzymatic rates in H₂O versus D₂O can reveal rate-limiting proton transfer steps involving nuoK during the catalytic cycle.

  • Chimeric constructs: Creating chimeric proteins where segments of nuoK from Methylobacterium are replaced with corresponding regions from other bacteria can identify species-specific adaptations in proton translocation mechanisms.

These approaches can address fundamental questions about how electron transfer through the redox centers of NADH-quinone oxidoreductase is coupled to proton movement through the membrane domain containing nuoK, a central unresolved question in bioenergetics.

What insights might nuoK studies provide about the evolution of energy conservation mechanisms in alphaproteobacteria?

Studies of nuoK from Methylobacterium can provide valuable insights into the evolution of bioenergetic systems:

  • Ancestral features: Alphaproteobacteria are evolutionarily significant as the likely ancestors of mitochondria. Comparing nuoK from Methylobacterium with its mitochondrial homolog (ND4L) can reveal ancestral features of respiratory complexes before the endosymbiotic event.

  • Metabolic adaptations: Methylobacterium species have evolved to utilize C1 compounds , requiring specialized energy conservation mechanisms. Studying how nuoK contributes to this lifestyle can reveal how respiratory complexes adapt to new metabolic niches.

  • Horizontal gene transfer assessment: Comparative genomic analysis of nuoK sequences across alphaproteobacteria can reveal potential instances of horizontal gene transfer versus vertical inheritance, providing insights into the evolution of respiratory chains.

  • Structural adaptation mechanisms: Understanding how the structure of nuoK has been preserved or modified across species with different metabolic capabilities can reveal the constraints and flexibility in the evolution of membrane protein complexes.

This evolutionary perspective is critical not only for understanding bacterial adaptation but also for insights into mitochondrial disorders in humans that involve homologous components of respiratory Complex I.

What are common challenges in expressing and purifying functional recombinant nuoK, and how can they be addressed?

Researchers frequently encounter several challenges when working with hydrophobic membrane proteins like nuoK:

  • Poor expression levels:

    • Challenge: Hydrophobic proteins often express poorly and can be toxic to host cells.

    • Solution: Optimize by using specialized expression strains (C41/C43), lower induction temperatures (16-20°C), and reduced inducer concentrations. Consider using specialized vectors with tunable promoters to control expression levels precisely.

  • Inclusion body formation:

    • Challenge: Overexpressed membrane proteins often aggregate in inclusion bodies.

    • Solution: Co-express molecular chaperones (GroEL/GroES), optimize media composition (including addition of glycerol), and add membrane-mimetic compounds to expression media.

  • Inefficient membrane insertion:

    • Challenge: Even when expressed, nuoK may not properly insert into membranes.

    • Solution: Consider using fusion partners that assist membrane targeting, such as Mistic or YidC, which have been successful for other membrane proteins.

  • Protein instability during purification:

    • Challenge: Isolated nuoK may rapidly denature once removed from the membrane environment.

    • Solution: Screen multiple detergents systematically. Consider newer amphipathic polymers like SMALPs that extract membrane proteins with their native lipid environment intact.

  • Verifying proper folding:

    • Challenge: Determining if recombinant nuoK is correctly folded can be difficult.

    • Solution: Compare CD spectra with predicted secondary structure content, use limited proteolysis to verify compact structure, and employ binding assays with known interaction partners.

A systematic approach addressing each of these challenges sequentially has proven most effective for obtaining functional recombinant membrane proteins from bacterial expression systems.

What controls and validation steps are essential when studying reconstituted NADH-quinone oxidoreductase complexes containing recombinant nuoK?

Rigorous controls are essential for reliable results with reconstituted complexes:

  • Activity controls:

    • Empty liposomes/nanodiscs (negative control)

    • Liposomes with only the soluble domains of the complex

    • Full complex with inactivated nuoK (via mutation of key residues)

    • Native complex isolated from Methylobacterium (positive control, when feasible)

  • Integrity controls:

    • Proteoliposome integrity verification (dye leakage assays)

    • Protein:lipid ratio determination and optimization

    • Orientation analysis of reconstituted complex (using antibodies against domains with known topology)

  • Essential validation steps:

    • Correlation between enzyme amount and activity (linearity check)

    • Inhibitor sensitivity profile matching native complex

    • Cofactor content verification (flavin, iron-sulfur clusters)

    • Subunit stoichiometry analysis by quantitative mass spectrometry

  • Statistical considerations:

    • Biological replicates using independent protein preparations

    • Technical replicates to assess method variability

    • Appropriate statistical tests for comparing wild-type and mutant constructs

The gold standard for validation is demonstrating that recombinant nuoK can restore activity when incorporated into a complex lacking this subunit, either in vitro through reconstitution experiments or in vivo through complementation of a nuoK deletion strain.

How should researchers approach data inconsistencies when comparing native and recombinant forms of NADH-quinone oxidoreductase?

When faced with inconsistencies between native and recombinant systems, researchers should follow this systematic troubleshooting approach:

By systematically addressing potential sources of discrepancy, researchers can determine whether differences represent technical artifacts or biologically meaningful insights into the structure and function of NADH-quinone oxidoreductase complexes.

How might cryogenic electron microscopy (cryo-EM) advance our understanding of nuoK structure and function?

Recent advances in cryo-EM offer unprecedented opportunities for nuoK research:

  • Structural determination without crystallization: Unlike X-ray crystallography, cryo-EM can determine structures of membrane protein complexes without the need for crystallization, which has traditionally been a major bottleneck for proteins like nuoK.

  • Visualizing different conformational states: Modern cryo-EM methods can capture different conformational states within a single sample, potentially revealing how nuoK changes conformation during the catalytic cycle of NADH-quinone oxidoreductase.

  • Complex assembly visualization: Cryo-EM can be used to study partially assembled complexes, providing insights into how nuoK incorporates into the larger NADH-quinone oxidoreductase complex.

  • Technical approaches:

    • Single-particle analysis of detergent-solubilized or nanodisc-reconstituted complexes

    • Subtomogram averaging of complexes visualized in native membrane environments

    • Time-resolved cryo-EM to capture short-lived intermediate states

  • Integration with functional data: Combining cryo-EM structures with results from mutagenesis and functional studies can create a comprehensive model of nuoK's role in proton translocation.

Recent advances have made it possible to achieve near-atomic resolution even for relatively small membrane proteins, making cryo-EM a particularly promising approach for nuoK structural studies where traditional crystallography has proven challenging.

What roles might synthetic biology approaches play in advancing nuoK research?

Synthetic biology offers innovative approaches to nuoK research:

  • Minimal NADH-quinone oxidoreductase design: Engineering simplified versions of the complex containing only essential components can help identify the minimal structural requirements for nuoK function.

  • Domain swapping and chimeric proteins: Creating chimeric proteins where domains of nuoK from different species are interchanged can identify species-specific adaptations and essential functional regions.

  • Orthogonal expression systems: Developing expression systems that produce nuoK with minimal interference with host metabolism can improve yield and functional incorporation.

  • In vivo directed evolution: Implementing selection systems for improved nuoK variants can identify unexpected features that enhance activity or stability.

  • Non-natural amino acid incorporation: Strategic placement of spectroscopic probes or photocrosslinking amino acids can provide new insights into nuoK dynamics and interactions.

These approaches allow researchers to move beyond studying natural variants of nuoK to designing experiments that directly test mechanistic hypotheses through rational protein engineering, potentially revealing features that would be difficult to discover through conventional approaches.

How might genomic and metagenomic analyses expand our understanding of nuoK diversity across methylotrophic bacteria?

Genomic and metagenomic approaches can provide broader evolutionary context:

  • Comparative genomics across methylotrophs: Analyzing nuoK sequences from diverse methylotrophic bacteria can reveal adaptations specific to C1 metabolism across different evolutionary lineages.

  • Environmental metagenomics: Examining nuoK diversity in environments where methylotrophs thrive (plant surfaces, soil, freshwater) can uncover novel variants with potentially unique properties.

  • Structure-function correlations: Mapping sequence variations onto structural models can identify coevolving residues that maintain critical interactions across divergent sequences.

  • Horizontal gene transfer assessment: Phylogenetic analysis of nuoK sequences relative to organismal phylogenies can reveal instances of horizontal gene transfer that may indicate selective advantages of certain nuoK variants.

  • Correlation with ecological niches: Linking nuoK sequence features with the ecological distribution of different Methylobacterium species can reveal potential adaptations to specific environments.

This broader perspective can identify conserved features that are essential for function across all methylotrophs, as well as variable regions that may contribute to niche-specific adaptations in different methylotrophic lineages.

What integrated experimental approaches will most likely lead to breakthroughs in understanding nuoK function?

The most promising approaches for nuoK research combine multiple complementary methods:

  • Structure-function integration: Combining high-resolution structural studies (cryo-EM or crystallography) with systematic mutagenesis and functional assays to create a dynamic model of nuoK function within the complex.

  • Multi-scale temporal analysis: Integrating fast time-scale measurements (electron transfer, proton movements) with slower processes (conformational changes, complex assembly) to understand how nuoK contributes to the complete catalytic cycle.

  • In vitro-in vivo correlations: Connecting observations from purified components and reconstituted systems with phenotypic studies of nuoK variants in living cells to ensure biological relevance.

  • Comparative systems analysis: Studying nuoK function across multiple methylotrophic species with different metabolic capabilities to identify conserved mechanisms and species-specific adaptations.

  • Computational-experimental feedback loops: Using computational models to guide experimental design, then refining models based on experimental results in an iterative process.

These integrated approaches are essential for addressing the complexity of membrane protein bioenergetics and placing nuoK function in its proper cellular and evolutionary context.

How might nuoK research contribute to broader understanding of methylotrophic metabolism and bacterial energetics?

Research on nuoK extends beyond this single protein to inform broader scientific questions:

  • Energy conservation in specialized metabolic niches: Understanding how respiratory chains adapt to support specialized metabolism like methylotrophy can reveal general principles of metabolic evolution and adaptation.

  • Molecular mechanisms of proton pumping: Insights from nuoK can contribute to the fundamental understanding of how protein structures create proton pathways across membranes, a central question in bioenergetics.

  • Evolution of respiratory complexes: Comparing nuoK across diverse bacteria provides insights into how complex multisubunit membrane proteins evolve and adapt to different environments and metabolic requirements.

  • Metabolic engineering applications: Detailed understanding of nuoK function could enable engineering of bacterial respiratory chains with improved efficiency for biotechnological applications involving methylotrophic bacteria.

  • Mitochondrial disease models: Due to the evolutionary relationship between bacterial respiratory complexes and mitochondrial Complex I, insights from bacterial nuoK can inform understanding of mitochondrial diseases involving homologous subunits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.