Recombinant Methylocella silvestris Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its incorporation.
Synonyms
lspA; Msil_2861; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Target Names
lspA
Target Protein Sequence
MSPRVLGALVAALTLAADQANKLWLIFVYGIEQRQPIALAPFLDVVYAKNPGISYSLLSA RTDFQRYALLGLTLAATIFMILWLWRSTSKLIACALGLIIGGALGNAYDRAAYGFVADFY HFHVGSFSWYVFNLADAAIVAGVALLLYDSLFSARGAGTGGKSRGEGASAL
Uniprot No.

Target Background

Function

This protein is a recombinant Methylocella silvestris Lipoprotein signal peptidase (LspA) that specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylocella silvestris and why is its LspA protein significant for research?

Methylocella silvestris is a facultative methanotrophic bacterium that can uniquely grow on both methane and substrates containing carbon-carbon bonds (such as acetate), unlike other aerobic methanotrophs which are typically obligate methane-users . The lipoprotein signal peptidase (LspA) in bacteria is responsible for processing lipoproteins, which are critical components of the bacterial cell envelope. While not directly characterized in M. silvestris from our search results, LspA enzymes are generally essential in Gram-negative bacteria and contribute to virulence in Gram-positive organisms . Studying M. silvestris LspA provides valuable insights into both bacterial lipoprotein processing and the unique metabolic capabilities of facultative methanotrophs.

What expression systems are most effective for producing recombinant M. silvestris LspA?

Based on successful approaches with other bacterial LspA proteins, E. coli expression systems using pET vectors (such as pET28a) with hexahistidine tags are recommended for M. silvestris LspA expression . For optimal expression, consider the following protocol:

  • Clone the codon-optimized lspA gene into pET28a using NdeI and XhoI restriction sites

  • Transform into E. coli C43(DE3) cells, which are specifically designed for membrane protein expression

  • Culture in TB (Terrific Broth) medium supplemented with appropriate antibiotics (e.g., 50 μg/mL kanamycin)

  • Induce expression at OD600 0.5-0.6 with 1 mM ISOPROPYL β-D-1-thiogalactopyranoside

  • Continue expression at lower temperatures (28-30°C) for 18 hours to enhance protein folding

This approach has demonstrated successful expression of functional LspA from other bacterial species and should be adaptable for M. silvestris LspA.

How can I verify the purity and identity of recombinant M. silvestris LspA preparations?

Multiple complementary approaches should be employed to ensure both purity and proper identification:

  • SDS-PAGE analysis: Should show a single band at the expected molecular weight

  • Western blotting: Using anti-His antibodies (if His-tagged) or custom antibodies against LspA

  • Mass spectrometry: For peptide mass fingerprinting and sequence confirmation

  • Enzymatic activity assays: Using synthetic lipoprotein substrates

  • Protein quantification: Bradford or BCA assays to determine protein concentration

For highest confidence, combine these methods with controls such as testing inhibition with known LspA inhibitors like globomycin or myxovirescin to confirm that your preparation exhibits the expected biochemical properties .

How does the enzymatic mechanism of M. silvestris LspA compare to LspA from pathogenic bacteria?

While specific structural data for M. silvestris LspA is not available in our search results, insights can be drawn from related LspA enzymes. LspA functions as an aspartyl protease with a catalytic dyad of aspartate residues. Based on structural studies of S. aureus LspA, inhibitors like globomycin and myxovirescin target this catalytic site by positioning a hydroxyl group between the dyad residues, mimicking the tetrahedral intermediate of the catalytic reaction .

For experimental comparison between M. silvestris LspA and pathogenic homologs, consider:

  • Site-directed mutagenesis of predicted catalytic residues to confirm mechanism conservation

  • Inhibition studies with globomycin and myxovirescin to assess binding site conservation

  • Kinetic analysis with synthetic peptide substrates representing various lipoprotein signal sequences

  • Structural analysis through crystallography or cryo-EM to identify unique features

These approaches would determine whether M. silvestris LspA shares the conserved catalytic mechanism or has evolved unique features related to the organism's facultative methanotrophic lifestyle.

What experimental approaches can resolve contradictory data regarding substrate specificity of M. silvestris LspA?

When facing contradictory results about substrate specificity, implement a systematic multi-method validation approach:

  • Genetic complementation: Express M. silvestris LspA in an lspA-deficient strain to determine functional rescue with different substrates

  • In vitro enzyme assays: Use purified recombinant enzyme with various fluorescently labeled peptide substrates to directly measure activity

  • Mass spectrometry analysis: Identify cleavage products to confirm exact cleavage sites

  • Real-time monitoring: Employ techniques such as surface plasmon resonance (SPR) to measure binding constants with different substrates

  • Cross-validation: Compare results between laboratories using standardized protocols and materials

When analyzing contradictory data, carefully examine differences in experimental conditions, protein constructs (full-length vs. truncated), and assay methods. Consider creating a systematic data table comparing experimental variables across studies to identify potential sources of discrepancy.

How can the dual-substrate metabolism of M. silvestris inform the design of LspA activity assays?

M. silvestris's unique ability to grow on both methane and multicarbon substrates like acetate presents valuable opportunities for designing specialized activity assays for its LspA . Consider the following approaches:

  • Dual-culture system assays: Design experiments where M. silvestris cultures are grown on different carbon sources (methane vs. acetate) to examine whether LspA expression or activity differs based on metabolic state

  • qPCR monitoring: Similar to methods used to track mmoX gene expression , develop qPCR assays to quantify lspA expression under different growth conditions

  • Proteomics comparison: Analyze the lipoprotein profile processed by LspA under different metabolic states using mass spectrometry

  • Fluorescent reporter systems: Create reporter constructs linking LspA activity to fluorescent protein expression under different metabolic conditions

Data comparison table for LspA activity under different growth conditions:

Growth SubstrateLspA Expression LevelLipoprotein Processing EfficiencyDominant Lipoprotein Types
Methane[Experimental data][Experimental data][Experimental data]
Acetate[Experimental data][Experimental data][Experimental data]
Succinate[Experimental data][Experimental data][Experimental data]

This approach would provide insights into whether M. silvestris adapts its lipoprotein processing machinery based on its metabolic state.

What are the optimal purification protocols for maintaining M. silvestris LspA activity?

As a membrane-associated enzyme, LspA requires careful handling during purification. The following protocol is recommended:

  • Cell lysis: Use gentle methods such as osmotic shock or enzymatic lysis with lysozyme rather than sonication

  • Membrane fraction isolation: Perform differential centrifugation (low-speed followed by ultracentrifugation)

  • Detergent solubilization: Test multiple detergents including:

    • n-Dodecyl-β-D-maltoside (DDM): 1-1.5% for initial solubilization

    • n-Decyl-β-D-maltoside (DM): 0.5-1%

    • Lauryl maltose neopentyl glycol (LMNG): 0.5-1%

  • Affinity purification: Use nickel-NTA chromatography for His-tagged constructs

  • Size exclusion chromatography: For final purification and buffer exchange

  • Storage conditions: Maintain in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02-0.05% DDM, 10% glycerol at -80°C

Throughout purification, maintain samples at 4°C and include protease inhibitors to prevent degradation. Testing multiple detergent conditions in small-scale experiments before proceeding to large-scale purification is highly recommended.

How can I design primers for accurate cloning and verification of the M. silvestris lspA gene?

Design considerations for M. silvestris lspA gene amplification and cloning:

  • Sequence verification: First confirm the complete lspA sequence from M. silvestris genomic data

  • Primer design parameters:

    • Length: 25-30 nucleotides

    • GC content: 40-60%

    • Tm (melting temperature): 58-62°C

    • Add restriction sites with 6-base overhangs for cloning

    • Consider adding sequences for tags (His-tag) and protease cleavage sites

  • Verification strategy:

    • Design sequencing primers every 400-500 bp

    • Include primers that anneal to the vector sequences flanking the insert

    • Create primers for real-time PCR quantification similar to those used for mmoX gene verification

When verifying successful cloning, employ multiple methods including restriction digestion, PCR screening, and complete sequencing of the insert to ensure no mutations were introduced during amplification.

How does M. silvestris LspA function in relation to the organism's unique facultative metabolism?

M. silvestris's ability to grow on both methane and multicarbon substrates suggests its LspA may process different sets of lipoproteins depending on metabolic state . To investigate this relationship, consider:

  • Comparative lipidomics: Analyze the membrane lipid composition under methane versus acetate growth

  • Transcriptomics: Perform RNA-Seq to identify co-expressed genes during different growth conditions

  • Proteomic analysis: Use quantitative proteomics to determine which lipoproteins are processed under different metabolic states

  • Gene knockout studies: Create lspA knockout mutants and assess growth on different carbon sources

  • Complementation experiments: Reintroduce wild-type or mutant lspA to assess functional rescue

The facultative lifestyle of M. silvestris provides a unique opportunity to study how lipoprotein processing may adapt to different metabolic states, unlike in obligate methanotrophs where such comparison is not possible .

What structural features of M. silvestris LspA might explain substrate recognition specificity?

Based on structural studies of LspA from other bacteria, key features likely involved in substrate recognition include:

  • Transmembrane helices: Form a substrate-binding pocket accessible from the membrane

  • Catalytic aspartate residues: Form the active site dyad essential for peptide cleavage

  • Surface loops: Determine substrate specificity through selective interactions

  • Binding pockets: Accommodate the diacylglyceryl moiety of lipoprotein substrates

To experimentally investigate these features in M. silvestris LspA:

  • Generate a homology model based on crystal structures of related LspA proteins

  • Perform site-directed mutagenesis of predicted binding site residues

  • Conduct molecular dynamics simulations to predict substrate interactions

  • Attempt crystallization with and without inhibitors like globomycin

Understanding these structural features could reveal adaptations specific to M. silvestris's unique ecological niche and metabolic capabilities .

How can I overcome low expression yields of recombinant M. silvestris LspA?

Low expression of membrane proteins like LspA is a common challenge. Implementation of these strategies can improve yields:

  • Strain optimization:

    • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta)

    • Consider Methylocella-derived expression systems for native folding

  • Expression conditions:

    • Reduce induction temperature to 16-20°C

    • Decrease IPTG concentration to 0.1-0.5 mM

    • Extend expression time to 24-48 hours

    • Test auto-induction media formulations

  • Construct optimization:

    • Create fusion proteins with solubility-enhancing partners (MBP, SUMO)

    • Test truncated constructs removing non-essential regions

    • Optimize codon usage for expression host

  • Scale-up strategies:

    • Implement fed-batch cultivation to achieve higher cell densities

    • Use bioreactors with controlled dissolved oxygen and pH

Document all optimization experiments in a systematic table comparing yields across different conditions to identify optimal parameters for your specific construct.

What approaches can resolve contamination issues in M. silvestris cultures during LspA studies?

When studying LspA in M. silvestris cultures, maintaining pure cultures is essential, especially given its unique metabolic capabilities that could be confused with contamination . Implement these verification methods:

  • Microscopy verification: Phase-contrast microscopy to verify the characteristic bipolar shape with refractile deposits at each pole typical of Methylocella

  • Molecular verification:

    • 16S rRNA gene sequencing of multiple clones

    • Species-specific PCR targeting unique genomic regions

    • Whole-cell hybridization with fluorescently labeled oligonucleotide probes specific for M. silvestris

  • Functional verification:

    • Most-probable-number (MPN) dilution experiments to verify equal numbers of methane and acetate-utilizing cells

    • Parallel tracking of gene markers (like mmoX) and cell counts to ensure population homogeneity

  • Culture management:

    • Regular streaking on selective media

    • Maintenance of proper antibiotics if using recombinant strains

    • Regular verification of pure cultures between experiments

These rigorous approaches ensure experimental results reflect true M. silvestris biology rather than contaminating organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.