Recombinant Methylocella silvestris Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methylocella silvestris YidC

Recombinant Methylocella silvestris Membrane Protein Insertase YidC (Msil_1201) is a bioengineered form of the native YidC protein, a bacterial membrane protein insertase critical for integrating transmembrane proteins into lipid bilayers. Native YidC proteins are conserved across bacteria, archaea, and eukaryotic organelles, functioning autonomously or in concert with the Sec translocase to facilitate co-translational membrane protein insertion . The M. silvestris ortholog (Msil_1201) is expressed in heterologous systems (e.g., E. coli, yeast, baculovirus, or mammalian cells) for structural, functional, and biochemical studies .

Functional Roles in Membrane Protein Biogenesis

YidC mediates Sec-independent and Sec-dependent insertion pathways:

Sec-Independent Insertion

  • Mechanism: YidC binds nascent polypeptides via its cytoplasmic hairpin and transfers them to the hydrophilic groove, enabling lateral release into the lipid bilayer .

  • Substrates: Includes single-pass proteins (e.g., Pf3 coat protein) and polytopic proteins (e.g., melibiose permease MelB) .

  • Kinetics: Binding occurs within 2 ms, with full insertion completed in 52 ms under single-molecule force spectroscopy .

Interaction with Sec Translocase

In E. coli, YidC collaborates with SecYEG to release substrates from the translocon into the membrane . Structural models propose that YidC’s TM1 helix tilts to accommodate SecY interactions, enabling dual chaperone/insertase functions .

Production Systems

HostPurityYieldUse Case
E. coli≥85% (SDS-PAGE)High (mg quantities)Structural studies, in vitro assays
Yeast/Baculovirus≥85%ModeratePost-translational modification studies
Mammalian cells≥85%LowEukaryotic membrane protein studies

Note: Recombinant YidC retains functional activity, as demonstrated by in vitro membrane integration of Pf3 coat protein .

Research Applications

  1. Structural Studies: Cryo-EM and MD simulations to resolve YidC-substrate dynamics .

  2. Functional Screens: Testing substrate specificity (e.g., M13 procoat, F0c ATPase subunit) .

  3. Interactome Mapping: Identifying YidC partners like YibN, which enhances substrate biogenesis .

Key Discoveries

  1. Dual-Function Mechanism: YidC alternates between insertase (substrate insertion) and chaperone (SecY interaction) conformations via TM1 and C1 domain repositioning .

  2. Substrate Chaperoning: YidC reduces misfolding of polytopic proteins (e.g., MelB) by guiding stepwise insertion of folding cores .

  3. Lipid Interactions: Bilayer thinning near TM3/TM5 facilitates substrate release into the membrane .

Challenges

  • Species-Specific Variations: M. silvestris YidC lacks the N-terminal TM1 helix in some orthologs, potentially altering substrate interactions .

  • Functional Redundancy: Partial cross-complementation between gram-positive and gram-negative YidC orthologs complicates evolutionary studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please include your request in the order notes. We will strive to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For optimal long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize developing your specified tag.
Synonyms
yidC; Msil_1201; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Target Names
yidC
Target Protein Sequence
MNKDSRNLYLAIGLSCLVIVGWSYIFAPKQADRARLAQTQSQNAPAGTQPQSAATPQDAA NFSPLDALPKTRAEALAASPRLKIDTPAIFGSLSLKGARLDDVSLKGYRETVDPNSPNIV LLSPQGAPDAYYAEAGFVPAPGEAVAVPRSDTVWTADRDALTPEAPVTLTYDNGQGLVFH RQIAVDDRFMFTIKDSVENKSAKPVTLASYALVARHGLPKTVNYAVLHEGFVGVIGDAGV QEFHYDKIEKEDHGYKTFSGAGGWLGFTDKYWAATVIPDQAAPIEARFSANSTPSGIKTY RADFVGPVQTIAPGATTEAMSRVFAGAKEVHTLDAYQADLGIKKFELLIDWGWFYFITRP MFRLLHFLYSLTGNFGVAILLATVIVKGLFFPLANKSYLSMAKMKAVAPEIAALREKYPE DKMKQQQETMALYKREKINPVSGCLPMLIQIPVFFALYKVLFVTIEMRHAPFFGWIHDLS APDPTNLFNLFGLLPFDPTQLPLIGHFLAIGVWPLLMGVSMFVQMKANPEPADPMQKQIF TWMPVIFTFTLGGFPVGLVIYWTWNNILSVSQQTLIMKRAGVKVELFDNLASLFRKKVTS
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Additionally, YidC aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YidC in bacterial membranes?

YidC is a universally conserved protein that mediates the integration of most membrane proteins into the cytoplasmic membrane of bacteria. This process occurs co-translationally as proteins are being synthesized by ribosomes. YidC can function either individually as a membrane protein insertase or collaboratively with the SecY complex to facilitate proper insertion of nascent membrane proteins . Its fundamental role in protein translocation makes it essential for bacterial cellular function and viability. The protein acts as a molecular chaperone that facilitates the proper folding and insertion of newly synthesized membrane proteins, ensuring they adopt their correct three-dimensional structure within the lipid bilayer .

What is the structural organization of the conserved domains in YidC?

The structural model of YidC reveals a distinctive arrangement of five conserved transmembrane (TM) domains plus a helical hairpin between TM2 and TM3 located on the cytoplasmic membrane surface . Covariation analysis, lipid exposure prediction, molecular dynamics simulations, and in vivo complementation analyses have collectively confirmed this structural arrangement . The model shows that hydrophobic residues on the exterior of the TM bundle stabilize interactions with apolar lipid tails, while the YidC core is stabilized through both short and long-range interactions between the five helices. Residues toward the cytoplasmic side of the core are primarily polar or charged, while residues on the periplasmic side are predominantly aromatic .

What expression systems are commonly used for producing recombinant YidC?

Recombinant Methylocella silvestris Membrane protein insertase YidC can be produced using various expression systems, each offering distinct advantages depending on research requirements. The most common expression systems include:

  • Escherichia coli (bacterial system): Offers high yield and cost-effectiveness, suitable for basic structural studies

  • Yeast (eukaryotic system): Provides post-translational modifications closer to higher organisms

  • Baculovirus-insect cell system: Yields higher amounts of properly folded protein with more complex modifications

  • Mammalian cell expression: Provides the most native-like post-translational modifications, although with typically lower yields

The choice of expression system should be guided by specific experimental needs, including requirements for protein modifications, yield considerations, and downstream applications.

What methodologies are used to study YidC-mediated membrane insertion?

Researchers employ multiple complementary approaches to study YidC-mediated membrane insertion:

  • Molecular Dynamics (MD) Simulations: Both equilibrium and non-equilibrium MD simulations have proven effective for investigating YidC-mediated membrane insertion . These computational approaches allow visualization of dynamic protein-membrane interactions at the atomic level.

  • Cryo-electron Microscopy: This technique has been used to reconstruct translating YidC-ribosome complexes carrying YidC substrates, revealing how a single copy of YidC interacts with the ribosome at the ribosomal tunnel exit .

  • Covariation Analysis: This approach predicts contacts between pairs of residues based on evolutionary coupling, helping to understand the structural arrangement of YidC's transmembrane domains .

  • In vivo Complementation Assays: These assays test the functional relevance of specific residues by creating alanine mutants and assessing their ability to complement YidC function in living cells .

  • Chemical Cross-linking: This technique has been used to identify interactions between YidC and its substrates, particularly involving TM3 and TM5 helices .

How does the membrane-thinning effect of YidC contribute to its insertase function?

YidC induces significant thinning of the lipid bilayer during molecular dynamics simulations, with a reduction of 7-10 Å resulting from the hydrophobic mismatch between the transmembrane helices and the membrane . This thinning effect is distributed similarly in both the upper and lower leaflets, with the thinnest region occurring in proximity to TM3 and TM5. These specific helices have been implicated in substrate binding through chemical cross-linking studies .

The functional significance of this membrane thinning appears to be in facilitating the energetically favorable insertion of membrane proteins. By reducing the hydrophobic thickness of the bilayer, YidC creates a more accommodating environment for the lateral movement of transmembrane segments from the protein-conducting channel into the lipid phase. The thinned membrane region likely reduces the energetic barrier for translocation of polar termini and loops of substrate proteins across the hydrophobic core of the lipid bilayer . This represents a critical aspect of the molecular mechanism underlying YidC-dependent membrane insertion that warrants further investigation through targeted mutations affecting the membrane-thinning capacity.

What is the mechanism of ribosome interaction with YidC during co-translational insertion?

The cryo-electron microscopy reconstruction of a translating YidC-ribosome complex reveals specific details about how YidC facilitates co-translational membrane protein insertion . A single copy of YidC interacts with the ribosome precisely at the ribosomal tunnel exit, positioning the nascent polypeptide chain to emerge directly toward the YidC insertion site .

The interaction interface involves specific regions of YidC that have evolved to recognize and bind to conserved elements of the bacterial ribosome. This positioning is crucial as it allows for immediate engagement of the emerging polypeptide chain by YidC. The site for membrane protein insertion has been identified at the YidC protein-lipid interface, creating a protected environment where the hydrophilic segments of substrate proteins can be shielded from the hydrophobic lipid environment until proper folding and insertion are achieved .

The hydrophilic environment on the cytoplasmic side of the YidC transmembrane bundle appears to play a key role in receiving the polar termini and loops of YidC substrates during the initiation of translocation . This region continues into a hydrophobic cluster of aromatic residues toward the periplasmic side, potentially creating a pathway for substrate translocation across the membrane.

What are the critical residues for YidC function and how do mutations affect insertion activity?

In vivo complementation assays have identified several residues critical for YidC function. Among the most important are T362 in TM2 and Y517 in TM6, which are positioned at the same height in the membrane . Alanine mutations of these residues completely inactivated YidC despite the mutant proteins being stably expressed, indicating that the loss of function was not due to protein instability but rather to disruption of essential functional interactions .

Several residues in proximity to this critical pair (F433, M471, and F505) show intermediate activity levels when mutated, suggesting a gradient of functional importance radiating from the T362/Y517 core interaction site . Residues located further away from this central functional region typically do not demonstrate significant effects when mutated, indicating their lesser role in the core insertase function .

The distribution of these functionally critical residues corresponds well with the predicted substrate interaction sites and the regions involved in membrane thinning, suggesting a mechanistic link between specific amino acid positions, local membrane deformation, and the protein's insertase activity. This structure-function relationship provides targets for designed mutations to probe the mechanistic details of YidC-mediated insertion.

How can we optimize expression and purification protocols for functional studies of recombinant YidC?

Optimizing expression and purification of functional recombinant YidC requires careful consideration of multiple parameters:

  • Expression System Selection: While E. coli systems provide high yields, they may not maintain full functionality compared to eukaryotic expression systems. For certain functional studies, insect cell or mammalian expression systems may better preserve native activity despite lower yields .

  • Tag Selection and Placement: The type and position of purification tags can significantly impact YidC function. Tag types should be determined during the manufacturing process based on specific experimental requirements . For studies requiring biotinylated protein, the Avi-tag system with E. coli biotin ligase (BirA) provides highly specific biotinylation of the AviTag peptide .

  • Reconstitution Methods: For functional assays, YidC must be reconstituted into a membrane environment that preserves its native activity. Options include:

    • Liposome reconstitution using defined lipid compositions (3:1 POPE:POPG has been successfully used for modeling bacterial membranes in MD simulations)

    • Nanodiscs for single-molecule studies

    • Supported bilayers for biophysical characterization

  • Quality Control Metrics: Purified YidC should be assessed for:

    • Homogeneity (>85% purity by SDS-PAGE)

    • Proper folding (circular dichroism spectroscopy)

    • Functional activity (substrate binding assays)

    • Stability in different buffer conditions and temperatures

Careful optimization of these parameters is essential for obtaining functionally relevant results in subsequent experimental studies.

What computational approaches can model YidC-substrate interactions during membrane insertion?

Advanced computational approaches for modeling YidC-substrate interactions include:

  • Covariation-based Modeling: Predicting contacts between pairs of residues based on direct evolutionary couplings has proven effective for generating initial structural models of YidC . This approach can be extended to predict YidC-substrate interactions by analyzing covariation patterns between YidC and its known substrates.

  • Molecular Dynamics Simulations: Both equilibrium and non-equilibrium MD simulations have been successfully employed to investigate YidC-mediated membrane insertion . These techniques can model:

    • Conformational changes during substrate engagement

    • Energetics of membrane thinning and insertion

    • Water and lipid reorganization during protein insertion

    • Free energy profiles for insertion pathways

  • Hybrid Approaches: Combining experimental data with computational models enhances accuracy:

    • Using cross-linking constraints to guide docking simulations

    • Integrating cryo-EM density maps with atomistic models

    • Employing Markov state models to identify insertion intermediates

  • Machine Learning Methods: Newer approaches incorporate neural networks trained on known membrane protein insertion mechanisms to predict:

    • Substrate specificity determinants

    • Insertion efficiency for novel substrates

    • Optimal insertion pathways and energetics

These computational approaches, when validated against experimental data, provide mechanistic insights that may be difficult to obtain through experimental methods alone.

How can we design experiments to distinguish between YidC-dependent and SecYEG-dependent insertion pathways?

Designing experiments to differentiate between YidC-dependent and SecYEG-dependent insertion pathways requires a multi-faceted approach:

  • Genetic Depletion Studies:

    • Create conditional depletion strains for YidC and SecYEG components

    • Monitor insertion of various substrate proteins under depletion conditions

    • Quantify insertion efficiency using reporter fusions or radiolabeling

  • In vitro Reconstitution Assays:

    • Purify YidC and SecYEG components separately

    • Reconstitute each into liposomes with defined compositions

    • Perform insertion assays using cell-free translation systems

    • Compare insertion efficiency with combined versus individual systems

  • Substrate Engineering:

    • Generate chimeric proteins with domains requiring different insertion pathways

    • Systematically modify transmembrane segment properties (hydrophobicity, length, charge)

    • Identify sequence determinants that direct proteins to either pathway

  • Cross-linking and Proximity Studies:

    • Use site-specific cross-linkers to capture transient interactions

    • Employ fluorescence resonance energy transfer (FRET) to measure dynamic associations

    • Map the interaction interfaces during insertion

  • Time-resolved Cryo-EM:

    • Capture insertion intermediates at different stages

    • Visualize ribosome-YidC-SecYEG supercomplexes

    • Determine the structural basis for pathway selection

These experimental approaches should be complemented with computational modeling to develop a comprehensive understanding of the decision-making process in membrane protein insertion pathway selection.

What are the best methods for analyzing YidC-induced membrane deformation?

Analysis of YidC-induced membrane deformation requires specialized techniques spanning computational, biophysical, and imaging approaches:

  • Molecular Dynamics Simulations:

    • Measure membrane thickness profiles around embedded YidC

    • Track lipid reorganization and water penetration

    • Quantify local curvature changes induced by YidC

  • Atomic Force Microscopy (AFM):

    • Image topography of membrane surfaces containing YidC

    • Measure mechanical properties of YidC-containing membranes

    • Perform force spectroscopy to characterize insertion mechanics

  • Neutron Reflectometry:

    • Determine membrane thickness with sub-nanometer resolution

    • Measure density profiles perpendicular to the membrane

    • Distinguish between protein and lipid contributions to membrane structure

  • Solid-state NMR Spectroscopy:

    • Analyze lipid order parameters in YidC-containing membranes

    • Measure lipid dynamics at the protein-lipid interface

    • Detect conformational changes in response to substrate binding

  • Fluorescence Microscopy Techniques:

    • Use environment-sensitive probes to detect hydrophobicity changes

    • Employ polarization microscopy to measure membrane order

    • Apply super-resolution techniques to visualize nanoscale membrane domains

  • Electron Microscopy:

    • Use cryo-EM to visualize membrane deformation in vitrified samples

    • Employ electron tomography for 3D characterization of membrane morphology

    • Apply correlative light and electron microscopy for functional-structural studies

The membrane thinning of 7-10 Å observed in MD simulations provides a starting point for experimental validation using these techniques.

How can contradictory results in YidC function studies be reconciled?

Contradictory results in YidC function studies can arise from multiple sources and require systematic approaches for reconciliation:

  • Expression System Differences:

    • YidC produced in different expression systems (E. coli, yeast, baculovirus, mammalian) may exhibit varying functional properties

    • Standardize expression systems or directly compare YidC from different sources in identical assays

  • Lipid Environment Variations:

    • YidC function is highly dependent on the surrounding lipid environment

    • The specific lipid composition (3:1 POPE:POPG ratio used in simulations) affects membrane thickness and YidC activity

    • Document and control lipid compositions across studies

  • Substrate-specific Effects:

    • Different YidC substrates may utilize distinct insertion mechanisms

    • Categorize results based on substrate properties (size, hydrophobicity, charge distribution)

    • Develop a substrate classification system based on insertion requirements

  • Methodology Considerations:

    • In vivo versus in vitro approaches may yield different results

    • Detection methods (fluorescence, radiolabeling, mass spectrometry) have varying sensitivities

    • Establish standard protocols and positive controls for key assays

  • Statistical Analysis Framework:

    • Apply meta-analysis techniques to quantitatively compare results across studies

    • Identify variables that correlate with outcome differences

    • Develop predictive models that account for experimental variations

By systematically addressing these factors, researchers can develop a more unified understanding of YidC function that accommodates apparently contradictory observations within a broader mechanistic framework.

What statistical approaches are most appropriate for analyzing YidC mutant phenotypes?

The analysis of YidC mutant phenotypes requires sophisticated statistical approaches to extract meaningful insights:

  • Hierarchical Clustering Analysis:

    • Group mutations based on similarity of phenotypic effects

    • Identify functional domains with shared phenotypic signatures

    • Correlate clusters with structural features of YidC

  • Principal Component Analysis (PCA):

    • Reduce the dimensionality of complex phenotypic data

    • Identify the most significant variables contributing to phenotypic variation

    • Visualize relationships between different mutations

  • Multinomial Logistic Regression:

    • Predict categorical outcomes (e.g., substrate specificity changes) based on mutation properties

    • Identify interactions between multiple mutations

    • Quantify the contribution of specific residues to different functional aspects

  • Bayesian Network Analysis:

    • Model causal relationships between mutations and phenotypic effects

    • Incorporate prior knowledge about protein structure and function

    • Update models as new experimental data becomes available

  • Machine Learning Classification:

    • Train algorithms to predict mutation effects based on sequence and structural features

    • Identify patterns that may not be apparent through traditional statistical approaches

    • Develop predictive models for designing targeted mutations

When analyzing complementation assays, such as those performed with T362 and Y517 alanine mutants , these statistical approaches can provide deeper insights into structure-function relationships beyond simple binary (functional/non-functional) classifications.

How can YidC research contribute to antimicrobial drug development?

YidC research offers several promising avenues for antimicrobial drug development:

  • Essential Function Targeting:

    • YidC is essential for bacterial viability and has no direct human homolog

    • Compounds that specifically inhibit YidC function could serve as novel antibiotics

    • Focus on the critical T362/Y517 interaction identified in functional studies

  • Structure-Based Drug Design:

    • The structural model of YidC provides a foundation for virtual screening

    • Target the hydrophilic cavity implicated in substrate reception

    • Design compounds that disrupt ribosome-YidC interactions

  • Substrate Insertion Interference:

    • Identify compounds that mimic YidC substrates but block the insertion channel

    • Develop peptide-based inhibitors targeting the YidC-substrate interface

    • Screen for molecules that prevent membrane thinning effects

  • Species-Specific Targeting:

    • Compare YidC structures across bacterial species to identify unique features

    • Design narrow-spectrum antibiotics targeting pathogen-specific YidC characteristics

    • Develop combination therapies targeting both YidC and SecYEG pathways

  • Delivery System Development:

    • Utilize understanding of membrane insertion mechanisms to design drug delivery systems

    • Create peptide conjugates that hijack YidC for membrane penetration

    • Develop membrane-thinning peptides to enhance antibiotic penetration

This research direction requires close collaboration between structural biologists, microbiologists, and medicinal chemists to translate mechanistic insights into therapeutic applications.

What are the future directions for understanding the evolution of YidC across different bacterial species?

Future research into YidC evolution should explore:

  • Comparative Genomics Analysis:

    • Perform comprehensive phylogenetic analysis of YidC across bacterial phyla

    • Identify conserved cores versus variable regions

    • Correlate evolutionary patterns with bacterial membrane composition and physiology

  • Ancestral Sequence Reconstruction:

    • Infer ancestral YidC sequences at key evolutionary nodes

    • Express and characterize these reconstructed proteins

    • Trace the evolutionary trajectory of insertion mechanism development

  • Horizontal Gene Transfer Assessment:

    • Evaluate evidence for horizontal gene transfer events in YidC evolution

    • Identify potential adaptive advantages conferred by YidC variants

    • Map co-evolution with other membrane protein insertion machinery

  • Structure-Function Relationships Across Species:

    • Compare the Methylocella silvestris YidC with homologs from diverse bacteria

    • Identify species-specific adaptations in substrate recognition and handling

    • Determine the structural basis for differences in insertion efficiency

  • Experimental Evolution Studies:

    • Subject bacteria to selection pressures that target membrane protein insertion

    • Monitor adaptive changes in YidC sequence and expression

    • Characterize the functional consequences of evolved variants

These evolutionary studies will provide context for understanding the fundamental mechanisms of membrane protein insertion and may reveal novel strategies for targeting this essential process in pathogenic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.