Recombinant Methylocella silvestris NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

The recombinant nuoK is produced via bacterial expression systems and purified to high purity:

ParameterValue
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol (final concentration)

Key Notes:

  • Stability: Avoid repeated freeze-thaw cycles. Store at -20°C/-80°C.

  • Applications: Used in biochemical assays, structural studies, and antibody development (e.g., ELISA kits) .

Role in NDH-1 Activity

NDH-1 complexes couple NADH oxidation to proton translocation, generating a proton gradient for ATP synthesis. In Methylocella, nuoK likely participates in this process, though its exact role differs from homologous subunits in Na⁺-pumping NADH-quinone oxidoreductases (Na⁺-NQR) . For example:

  • Electron Transfer: NDH-1 shuttles electrons from NADH to quinone via redox-active cofactors (e.g., FMN, Fe-S clusters) .

  • Proton Pumping: Hydrophobic subunits like nuoK may stabilize transmembrane helices or facilitate proton release, as seen in E. coli NuoM .

Evolutionary and Biochemical Context

nuoK belongs to a conserved family of NDH-1 subunits across bacteria. Unlike Na⁺-NQR, which lacks sequence homology to NDH-1 , the Methylocella nuoK shares structural motifs with E. coli NuoK, suggesting a common evolutionary origin. Its expression in E. coli highlights the compatibility of bacterial systems for producing functional recombinant proteins.

Applications in Research

  • Structural Studies: Cryo-EM/X-ray crystallography to elucidate NDH-1 architecture.

  • Functional Assays: Testing proton-pumping activity in reconstituted lipid bilayers.

  • Immunological Tools: Development of ELISA kits for detecting nuoK in bacterial lysates .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have a specific format requirement, kindly include it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributors.
For all protein shipments, we utilize standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
In general, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Msil_2928; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Target Names
nuoK
Target Protein Sequence
MILSLSHFLIVAAMLFTIGVAGIILNRKNIIVVLMSVELILLSVNINLVSFSSFFGDLTG QVFSLFVLTVAAAEAAIGLAILVAYYRNRGSIAVEDINMMKG
Uniprot No.

Target Background

Function
NDH-1 functions by transferring electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylocella silvestris and why is it significant for research?

Methylocella silvestris is a unique facultative methanotrophic bacterium with exceptional metabolic versatility. Unlike obligate methanotrophs that can only utilize methane, M. silvestris can grow on both one-carbon compounds (methane, methanol) and multi-carbon substrates (acetate, pyruvate, succinate, malate, and ethanol) . This versatility makes it particularly valuable for research into bacterial metabolism and potential biotechnological applications.

M. silvestris belongs to the Alphaproteobacteria (type II methanotrophs) but is phylogenetically distinct from other type II methanotrophs of the Methylosinus and Methylocystis genera. Interestingly, it is closely related to the nonmethanotrophic heterotroph Beijerinckia indica, making it the only known methanotroph with such close phylogenetic proximity to a nonmethanotroph .

The ability of M. silvestris to utilize both methane and components of natural gas such as propane makes it particularly abundant in natural gas seep environments, where it likely plays a critical ecological role in consuming greenhouse gases before they reach the atmosphere .

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in bacterial metabolism?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of Complex I in the electron transport chain, which is critical for energy metabolism in bacteria. In Methylocella silvestris, the nuoK protein (UniProt ID: B8EIM7) consists of 102 amino acids and is encoded by the Msil_2928 gene .

The protein functions as part of the NADH dehydrogenase I (NDH-1) complex, which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain. This process is fundamental to energy conservation in the form of a proton gradient across the membrane, which drives ATP synthesis.

Given the metabolic versatility of M. silvestris, the nuoK subunit likely plays a role in adapting the electron transport chain to different growth substrates, contributing to the organism's ability to thrive on various carbon sources including methane, ethane, propane, and other compounds .

What are the optimal storage conditions for recombinant Methylocella silvestris nuoK protein?

Optimal storage of recombinant M. silvestris nuoK protein requires careful handling to maintain structural integrity and functionality. The recommended storage protocol includes:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • When reconstituting, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% (or between 5-50%) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C/-80°C

It is critical to avoid repeated freeze-thaw cycles as they can compromise protein integrity. Centrifuging the vial briefly before opening is recommended to ensure all contents are at the bottom of the tube .

How can researchers investigate the relationship between nuoK function and the versatile metabolism of Methylocella silvestris?

Investigating the relationship between nuoK function and the metabolic versatility of M. silvestris requires a multifaceted approach that leverages the organism's unique ability to utilize diverse carbon sources.

Methodological approaches should include:

  • Comparative growth studies: Measure growth rates and yields of wild-type M. silvestris versus nuoK deletion mutants on different substrates (methane, acetate, propane). Previous studies with M. silvestris have demonstrated that growth yield (Yx/m) and efficiency are higher on acetate (20.5 ± 1.24 g dry cell material mol⁻¹ substrate, 40.1 ± 2.43% efficiency) than on methane (3.59 ± 0.104 g dry cell material mol⁻¹ substrate, 13.2 ± 0.698% efficiency) . Similar parameters should be measured for nuoK mutants.

  • Respiratory chain analysis: Measure NAD⁺/NADH ratios and ATP production in wild-type versus nuoK mutants under different growth conditions to quantify the impact on energy conservation.

  • Transcriptomic and proteomic analysis: Similar to the approach used in the genome-scale metabolic model of M. silvestris, integrate proteomic data to identify changes in expression of electron transport chain components when nuoK is deleted or overexpressed .

  • Isotope labeling experiments: Use ¹³C-labeled substrates to trace carbon flux through central metabolic pathways in the presence and absence of functional nuoK, particularly focusing on the glyoxylate shuttle which M. silvestris uniquely uses for assimilation of C1 and C2 substrates .

What methodologies are recommended for studying the interaction between nuoK and other components of the respiratory chain?

Understanding the interactions between nuoK and other respiratory chain components requires sophisticated biochemical and biophysical approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tagged nuoK protein to pull down interacting proteins from M. silvestris lysates.

  • Blue Native PAGE: To isolate intact respiratory complexes and identify the position of nuoK within the NADH dehydrogenase complex.

  • Cross-linking coupled with mass spectrometry: To identify amino acid residues involved in protein-protein interactions between nuoK and other subunits.

  • Cryo-electron microscopy: For structural analysis of the entire NADH dehydrogenase complex, including the arrangement of nuoK relative to other subunits.

  • FRET (Förster Resonance Energy Transfer): Using fluorescently labeled proteins to study dynamic interactions between nuoK and other components in real-time.

When interpreting results, researchers should consider the unique metabolic context of M. silvestris, particularly its ability to adapt its respiratory chain to different carbon sources, which might influence the configuration and interactions of the NADH dehydrogenase complex under different growth conditions .

How does nuoK function relate to the glyoxylate shuttle pathway unique to Methylocella silvestris?

The relationship between nuoK function and the glyoxylate shuttle pathway in M. silvestris represents an intriguing research question, as this bacterium uniquely employs the glyoxylate shuttle for assimilation of both C1 and C2 substrates .

To investigate this relationship, researchers should:

  • Conduct comparative metabolic flux analysis in wild-type and nuoK mutant strains growing on C1 (methane) versus C2 (acetate) substrates. This would reveal whether disruption of the electron transport chain via nuoK deletion differentially affects metabolism through the glyoxylate pathway.

  • Monitor glyoxylate cycle enzyme activities (isocitrate lyase and malate synthase) in response to varying nuoK expression levels. Previous studies have shown that deletion mutants lacking isocitrate lyase (ΔICL) show altered growth phenotypes , suggesting close integration between central carbon metabolism and energy conservation.

  • Analyze redox cofactor balances (NADH/NAD⁺, NADPH/NADP⁺) in wild-type versus nuoK mutants, as these likely connect electron transport chain function to central carbon metabolism.

  • Perform in silico analysis using the genome-scale metabolic model developed for M. silvestris to predict how perturbations in electron transport (via nuoK) would affect flux through the glyoxylate pathway under different growth conditions.

  • Examine transcriptional regulation to identify potential regulatory links between genes encoding nuoK and glyoxylate cycle enzymes under different metabolic states.

What are the challenges in expressing and purifying functional recombinant Methylocella silvestris nuoK protein?

Expressing and purifying functional M. silvestris nuoK presents several challenges due to its nature as a membrane protein component of a multi-subunit complex:

  • Membrane protein solubility: As nuoK is a membrane-integrated subunit with hydrophobic regions, solubilization requires careful optimization of detergents. Researchers should test a panel of detergents (e.g., DDM, LDAO, Triton X-100) at various concentrations.

  • Maintaining native conformation: Isolating nuoK from its natural complex may affect its structure. Consider co-expressing with adjacent subunits or using amphipols or nanodiscs to provide a membrane-like environment.

  • Protein stability: NADH dehydrogenase subunits often show limited stability when isolated. Optimize buffer conditions (pH, ionic strength, glycerol content) and consider adding specific lipids that might enhance stability.

  • Functional assessment: As a single subunit of a large complex, isolated nuoK may not display measurable enzymatic activity. Develop appropriate binding assays or structural techniques to verify the protein's functional state.

  • Expression system selection: While E. coli is commonly used , alternative expression systems (e.g., Methylocella itself or other methanotrophs) might provide better folding environments for obtaining functional protein.

When planning purification, researchers should implement quality control steps including circular dichroism to verify secondary structure content and thermal shift assays to optimize stabilizing conditions.

What experimental approaches are recommended for creating and validating nuoK deletion mutants in Methylocella silvestris?

Creating and validating nuoK deletion mutants in M. silvestris requires careful experimental design:

  • Mutant construction strategy:

    • Design primers targeting the nuoK gene (Msil_2928) with appropriate flanking regions

    • Consider the unmarked deletion approach previously used successfully for other M. silvestris genes

    • Ensure the mutation doesn't create polar effects on adjacent genes in the nuo operon

  • Transformation protocol:

    • Use electroporation techniques previously established for M. silvestris

    • Consider counterselection with sucrose if using sacB-based vectors

    • Plate on appropriate selective media with antibiotics

  • Verification methods:

    • PCR verification with primers flanking the deletion site

    • Whole-cell hybridization with fluorescently labeled oligonucleotide probes (as used in previous M. silvestris studies)

    • RT-PCR to confirm the absence of nuoK transcript

    • Proteomic analysis to confirm absence of nuoK protein

    • Whole genome sequencing to confirm the deletion and check for secondary mutations

  • Phenotypic validation:

    • Compare growth rates on different substrates (methane, acetate, propane) as done in previous M. silvestris studies

    • Measure respiratory chain activity using oxygen consumption assays

    • Quantify NAD⁺/NADH ratios in wild-type versus mutant

    • Monitor growth yield and efficiency parameters as previously established for M. silvestris (Yx/m)

  • Complementation studies:

    • Reintroduce the nuoK gene on a plasmid to restore wild-type phenotype

    • Consider complementation with nuoK genes from related species to test functional conservation

How can researchers accurately measure the enzymatic activities associated with the NADH dehydrogenase complex containing nuoK?

Measuring enzymatic activities of the NADH dehydrogenase complex containing nuoK requires sophisticated biochemical approaches:

  • Membrane preparation:

    • Isolate membrane fractions from M. silvestris grown on different substrates

    • Optimize membrane solubilization conditions to maintain complex integrity

  • NADH oxidation assay:

    • Spectrophotometrically monitor NADH oxidation at 340 nm

    • Include appropriate electron acceptors (e.g., ubiquinone analogues)

    • Use specific inhibitors (e.g., rotenone) to distinguish Complex I activity

  • Electron transfer measurements:

    • Use artificial electron acceptors of different reduction potentials

    • Measure activities across a range of pH values to determine pH optimum

  • Subcomplex activity:

    • Assess NADH dehydrogenase module activity separately from membrane arm activity

    • Compare activities in wild-type versus nuoK mutants to determine the specific role of nuoK

  • Proton pumping assays:

    • Use pH-sensitive fluorescent dyes or pH electrodes to measure proton translocation

    • Calculate H⁺/e⁻ ratios to assess coupling efficiency

  • Reconstitution experiments:

    • Purify individual components including recombinant nuoK

    • Attempt stepwise reconstitution of active subcomplexes

    • Measure activity recovery upon addition of purified nuoK

When interpreting results, consider the unique metabolic context of M. silvestris and how activities might differ when the organism is grown on different carbon sources (methane versus acetate) .

What controls should be included when studying the function of nuoK in different metabolic pathways?

Robust experimental design for studying nuoK function requires comprehensive controls:

  • Genetic controls:

    • Wild-type M. silvestris (positive control)

    • nuoK deletion mutant (ΔnuoK)

    • Complemented ΔnuoK strain (restoration control)

    • Deletion mutants of other respiratory complex genes (specificity controls)

    • Previously characterized mutants like ΔICL (isocitrate lyase) to compare with known metabolic defects

  • Metabolic controls:

    • Growth on different carbon sources (methane, acetate, propane) to test pathway-specific effects

    • Addition of respiratory inhibitors (e.g., antimycin A, rotenone) at sublethal concentrations

    • Oxygen-limited versus fully aerobic conditions to test respiratory flexibility

    • Addition of alternative electron acceptors

  • Biochemical controls:

    • Enzyme assays with heat-inactivated samples

    • Assays with purified subcomplexes missing nuoK

    • Addition of detergents at varying concentrations to test membrane integrity effects

  • Analytical controls:

    • Internal standards for metabolomic analyses

    • ¹³C-labeled substrates for metabolic flux analysis

    • Time course sampling to capture dynamic responses

    • Technical and biological replicates (minimum triplicate)

  • Expression controls:

    • qRT-PCR for nuoK and related genes under different conditions

    • Western blots to confirm protein levels in complementation studies

    • Fluorescent tagging to monitor protein localization

When analyzing results, researchers should use the previously established growth parameters for M. silvestris on different substrates as benchmarks (e.g., growth rates of 0.78 ± 0.053 day⁻¹ on methane versus 1.26 ± 0.035 day⁻¹ on acetate) .

How should researchers interpret contradictory findings regarding nuoK function in different experimental conditions?

Interpreting contradictory findings regarding nuoK function requires systematic analysis and consideration of M. silvestris' metabolic versatility:

  • Substrate-dependent effects:

    • M. silvestris shows different growth efficiencies on different carbon sources . Contradictions may reflect genuine differences in nuoK function or importance when utilizing methane versus multicarbon substrates.

    • Create a comparison matrix of nuoK phenotypes across all tested substrates and growth conditions.

  • Genetic background considerations:

    • Secondary mutations might arise during mutant construction. Whole genome resequencing of mutants showing contradictory phenotypes is essential.

    • Complementation studies should be performed to confirm phenotypes are directly attributable to nuoK.

  • Methodological reconciliation:

    • Different assay methods may yield conflicting results. Compare in vivo versus in vitro approaches.

    • Standardize growth conditions, cell harvest points, and enzyme assay protocols.

    • Consider how membrane preparation methods might affect complex integrity.

  • Integration with metabolic models:

    • Use the genome-scale metabolic model of M. silvestris to predict how nuoK perturbation might differentially affect various metabolic states.

    • Flux balance analysis can help resolve seeming contradictions by identifying condition-specific metabolic rerouting.

  • Temporal considerations:

    • Apparent contradictions may reflect different growth phases. Design time-course experiments.

    • Consider adaptation effects where compensatory mechanisms may mask initial phenotypes over time.

A suggested analysis framework includes:

  • Statistical meta-analysis of all available data

  • Bayesian network modeling to identify conditional dependencies

  • Principal component analysis to identify major factors driving apparent contradictions

What bioinformatic approaches can help understand nuoK function across methanotrophic bacteria?

Bioinformatic analysis provides valuable insights into nuoK function across methanotrophs:

Researchers should be particularly attentive to differences between methanotrophs that use the glyoxylate shuttle (like M. silvestris) versus those that use other pathways for carbon assimilation, as this may reveal functional adaptations in the respiratory chain .

What are the common challenges in purifying active recombinant nuoK protein and how can they be addressed?

Purifying active recombinant nuoK presents several challenges that researchers should anticipate:

  • Protein aggregation:

    • Challenge: Hydrophobic membrane proteins like nuoK often aggregate during expression or purification.

    • Solution: Screen multiple detergents (DDM, LDAO, Fos-choline) at various concentrations. Consider amphipols or nanodiscs for maintaining native-like environment.

  • Low expression yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for E. coli, test different E. coli strains (C41/C43 designed for membrane proteins), and consider lower induction temperatures (16-20°C).

  • Protein instability:

    • Challenge: Isolated nuoK may be unstable outside its native complex.

    • Solution: Include stabilizing agents (glycerol, specific lipids) in all buffers. Consider co-expression with interacting subunits.

  • Functional verification:

    • Challenge: As a single subunit, nuoK may not display measurable enzymatic activity.

    • Solution: Develop binding assays for interaction partners or substrate analogues. Use structural techniques (CD, FTIR) to verify proper folding.

  • Post-translational modifications:

    • Challenge: E. coli may not reproduce native modifications present in M. silvestris.

    • Solution: Consider expression in alternative systems closer to native context or identify modifications by mass spectrometry of native protein.

Troubleshooting protocol:

  • Begin with different solubilization conditions using the recommended reconstitution buffer (Tris/PBS-based, pH 8.0)

  • Perform small-scale expression tests varying temperature, induction time, and inducer concentration

  • Use SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to assess protein homogeneity

  • Test stability over time at different temperatures using DSF (Differential Scanning Fluorimetry)

How can researchers optimize experimental protocols for studying nuoK in the context of Methylocella silvestris' unique metabolic capabilities?

Optimizing experimental protocols for nuoK studies requires consideration of M. silvestris' unique metabolism:

  • Growth condition optimization:

    • Use DNMS (dilute nitrate mineral salts, pH 5.8) media as previously established for M. silvestris

    • For methane growth: supply 5-15% (vol/vol) methane to the headspace using sterile filtration

    • For acetate growth: add sodium acetate to DNMS at 0.04% (wt/vol) (6.8 mM)

    • For propane studies: consider both pathways of propane metabolism identified in M. silvestris

  • Gene expression analysis protocols:

    • Use quantitative real-time PCR targeting both nuoK and known metabolic marker genes

    • Include reference genes stable across different growth substrates

    • Compare expression patterns when growing on different substrates (methane vs. acetate vs. propane)

  • Protein localization techniques:

    • Optimize cell fixation protocols for M. silvestris' unique morphology (characteristic bipolar shape)

    • Develop fluorescent protein fusions compatible with M. silvestris' genetic system

    • Use specific antibodies against His-tagged recombinant nuoK for immunolocalization studies

  • Metabolic flux analysis:

    • Design tracer experiments appropriate for the glyoxylate shuttle pathway unique to M. silvestris

    • Measure fluxes during growth on different substrates to correlate with nuoK expression levels

    • Compare flux distributions between wild-type and nuoK mutants

  • Enzyme assays for respiratory complexes:

    • Adapt standard protocols for NADH dehydrogenase activity to the pH optimum of M. silvestris (pH 5.8)

    • Include controls with known inhibitors of different respiratory complexes

    • Measure activities across different growth phases and substrates

When working with M. silvestris, researchers should verify culture purity using established methods such as 16S rRNA gene sequencing and whole-cell hybridization with specific fluorescent probes , as contamination could confound results of metabolic studies.

What are the most promising future research directions for understanding nuoK function in Methylocella silvestris?

The study of nuoK in M. silvestris presents several promising research avenues:

  • Systems biology integration: Combining transcriptomics, proteomics, and metabolomics data to build a comprehensive model of how nuoK function influences global metabolism. This could build upon the existing genome-scale metabolic model for M. silvestris .

  • Comparative analysis across methanotrophs: Extending studies to compare nuoK function between facultative methanotrophs like M. silvestris and obligate methanotrophs to understand how respiratory chain components adapt to different metabolic lifestyles.

  • Structural biology approaches: Determining the structure of the complete NADH dehydrogenase complex from M. silvestris, with particular focus on nuoK's position and interactions, potentially revealing adaptations that support metabolic versatility.

  • Ecological relevance studies: Investigating how nuoK function contributes to M. silvestris' success in natural gas seep environments , potentially through experiments with environmental samples or microcosms.

  • Synthetic biology applications: Exploiting the understanding of nuoK to engineer M. silvestris for enhanced growth on methane or natural gas, leveraging its unique position as a genetically tractable facultative methanotroph with industrial biotechnology potential .

These directions would not only advance fundamental understanding of respiratory chain function in bacteria with versatile metabolism but could also contribute to applied fields including bioremediation and biomanufacturing using methane as a feedstock.

How can nuoK research contribute to our broader understanding of bacterial energy metabolism and adaptation?

Research on M. silvestris nuoK has broader implications for understanding bacterial energy metabolism:

  • Metabolic flexibility mechanisms: The study of nuoK in M. silvestris provides insights into how respiratory chains adapt to support growth on diverse carbon sources—a fundamental question in bacterial physiology.

  • Evolution of methanotrophy: Comparing nuoK across methanotrophs and related heterotrophs like Beijerinckia indica could reveal how respiratory complexes evolved during the transition to methanotrophic metabolism.

  • Acid tolerance mechanisms: As M. silvestris is acidophilic (growing optimally at pH 5.8) , understanding how its respiratory complexes function under acidic conditions could reveal adaptations relevant to acid tolerance in bacteria.

  • Methane bioeconomy applications: Insights from nuoK function could inform engineering efforts to develop M. silvestris as a platform organism for converting methane to value-added products, addressing both greenhouse gas mitigation and sustainable chemical production.

  • Ecological adaptation: Understanding how respiratory chain components like nuoK support M. silvestris' abundance in natural gas seeps contributes to our knowledge of how bacteria adapt to specific ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.