Recombinant Methylocella silvestris Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzyme Function and Biological Role

Lgt is essential for bacterial viability, as it initiates the three-step lipoprotein maturation process:

  1. Diacylglyceryl transfer: Lgt attaches a diacylglyceryl group to the thiol group of the prolipoprotein’s cysteine residue .

  2. Signal peptide cleavage by signal peptidase II (Lsp) .

  3. N-acylation by apolipoprotein N-acyltransferase (Lnt) in some bacteria .

In Methylocella silvestris, Lgt is encoded by the lgt gene (locus tag: Msil_1135) and shares functional homology with Lgt enzymes in Escherichia coli and other Gram-negative bacteria . Its activity enables proper localization of lipoproteins to the bacterial membrane, impacting nutrient uptake, signal transduction, and virulence .

Recombinant Production and Applications

Recombinant M. silvestris Lgt is produced for biochemical studies and industrial applications. Key details include:

ParameterDetails
Expression systemEscherichia coli
Expression regionAmino acids 1–272
TagUndisclosed (determined during production)
Storage bufferTris-based buffer with 50% glycerol
StabilityStable at -20°C long-term; working aliquots stable at 4°C for ≤1 week
ApplicationsLipoprotein modification studies, antibiotic target screening

Functional Insights from Homologs

Studies on E. coli Lgt provide mechanistic parallels:

  • Catalytic mechanism: PG binds to the periplasmic cavity, where the diacylglyceryl group is transferred to the prolipoprotein’s cysteine .

  • Essentiality: Knockout of lgt in E. coli is lethal, underscoring its role in cell envelope integrity .

  • Inhibition: Palmitic acid binds competitively in the PG-binding site, suggesting strategies for antibiotic development .

Biotechnological and Research Implications

  • Antibiotic development: Lgt is a promising target due to its essentiality and conservation across bacterial pathogens .

  • Methanotroph engineering: Understanding Lgt in M. silvestris could aid metabolic engineering for industrial methane conversion .

  • Protein interaction studies: Recombinant Lgt enables in vitro assays to probe lipoprotein maturation pathways .

Unresolved Questions and Future Directions

  • Do structural differences exist between M. silvestris Lgt and homologs in pathogenic bacteria?

  • How does Lgt interact with methane oxidation pathways in methanotrophs?

  • Can Lgt inhibitors be optimized for species-specific activity?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Msil_1135; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Target Names
lgt
Target Protein Sequence
MPFVIAYPVIDPVLLSIGPLPIRWYALAYIAGLVIGWAYARHLVARASFWGGRVRPDLGV IDDLLVYTALGVILGGRLGYVVFYNPAFYLSHPLDVFKLWQGGMSFHGGLVGAGVGVMLL ARRRGLPTLALGDIVSAVAPIGLFLGRIANFIKPELWGRPTDVPWAMVFPGAGDLPRHPS QLYEAAAEGALLFLLLFVAVRLGALKRSGLVTGLFAIGYGCARILCEFFREPDPQLGFLF GGATMGMLLSLPLIAAGLALVAFAYRREAVPA
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Methylocella silvestris* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of Lgt in Methylocella silvestris?

Lgt (Lipoprotein diacylglyceryl transferase) in Methylocella silvestris, as in other bacteria, catalyzes the first essential step in bacterial lipoprotein biogenesis. The enzyme transfers the diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in prolipoprotein substrates, forming a thioether bond. This modification is crucial for proper membrane anchoring of bacterial lipoproteins, which play vital roles in cell envelope integrity, nutrient acquisition, and other cellular processes . In M. silvestris specifically, this function is particularly interesting given the organism's unique metabolic versatility as a facultative methanotroph capable of growing on both methane and multicarbon substrates like acetate .

What expression systems are most effective for recombinant production of M. silvestris Lgt?

Based on research with other bacterial Lgt proteins, E. coli-based expression systems are typically employed for recombinant Lgt production. When expressing membrane proteins like Lgt, consider these methodological approaches:

  • Use expression vectors with tunable promoters (such as T7-lac or araBAD) to control expression levels

  • Express in E. coli strains optimized for membrane protein expression (C41/C43(DE3) or Lemo21(DE3))

  • Grow cultures at lower temperatures (16-25°C) after induction to slow protein synthesis and facilitate proper folding

  • Include appropriate fusion tags (His6, MBP, or SUMO) to aid in purification while maintaining enzyme function

For M. silvestris Lgt specifically, consider that this organism grows optimally under acidic conditions (pH 5.5) and has different membrane composition compared to E. coli, which may affect protein folding when expressed heterologously .

How can the enzymatic activity of recombinant M. silvestris Lgt be assayed?

The enzymatic activity of recombinant M. silvestris Lgt can be assayed using methods similar to those employed for E. coli Lgt:

  • Coupled luciferase assay: Measure the release of glycerol phosphate (G1P/G3P) as a by-product of the Lgt-catalyzed transfer reaction. This assay couples the detection of released glycerol phosphate to a luciferase reaction that produces a luminescent signal proportional to Lgt activity .

  • Radiolabeled substrate assay: Use radiolabeled phosphatidylglycerol (typically 14C- or 3H-labeled) and measure the transfer of the radioactive diacylglyceryl moiety to a synthetic peptide substrate containing the lipobox sequence with the conserved cysteine.

  • Western blot analysis: Monitor the conversion of prolipoprotein to its diacylglyceryl-modified form using antibodies specific to the prolipoprotein. The mobility shift between unmodified and modified forms can be detected on SDS-PAGE .

Assay MethodAdvantagesLimitationsDetection Limit
Coupled luciferaseHigh sensitivity, continuous monitoringPotential interference from sample components~0.1-0.5 μM G3P
Radiolabeled substrateDirect measurement of transfer reactionRequires radioisotope handling, discontinuous~1-5% conversion
Western blotVisualizes actual substrate modificationSemi-quantitative, labor-intensive~10-20% conversion

What are the key considerations for purifying recombinant M. silvestris Lgt?

Purification of recombinant M. silvestris Lgt requires strategies appropriate for membrane proteins:

  • Membrane extraction: Use appropriate detergents (DDM, LDAO, or Triton X-100) to solubilize the membrane-embedded Lgt while maintaining its native conformation and activity.

  • Affinity chromatography: If the recombinant protein contains an affinity tag (His6, etc.), use corresponding affinity resins for initial capture, with detergent present in all buffers.

  • Size exclusion chromatography: Further purify the protein by size exclusion chromatography to remove aggregates and ensure a homogeneous preparation.

  • Detergent exchange: Consider exchanging harsh solubilization detergents with milder ones (such as DDM or LMNG) for long-term storage and activity assays.

  • Quality control: Verify purity by SDS-PAGE and Western blotting, and assess the oligomeric state by analytical size exclusion chromatography or native PAGE.

When working specifically with M. silvestris Lgt, note that this organism grows optimally under acidic conditions, so its membrane proteins may have adapted features that affect detergent solubilization and stability compared to proteins from neutrophilic bacteria .

How does the structure-function relationship of M. silvestris Lgt compare to Lgt from other bacterial species?

The structure-function relationship of M. silvestris Lgt likely shares conservation with other bacterial Lgt enzymes while possessing unique features reflecting its specific ecological niche. Comparative analysis shows:

  • Conserved domains: Based on studies of Lgt from E. coli, S. aureus, and other species, expect M. silvestris Lgt to retain key catalytic residues. For instance, the S. aureus Lgt shows 24% identity and 47% similarity with E. coli Lgt while maintaining similar hydropathic profiles and functional capabilities .

  • Membrane topology: The predicted membrane topology of M. silvestris Lgt likely resembles that of other Lgt proteins, with multiple transmembrane domains and conserved regions corresponding to the active site and substrate binding pockets.

  • Species-specific adaptations: Given M. silvestris' acidophilic nature and unique metabolic capabilities as a facultative methanotroph , its Lgt may contain adaptations for function in acidic environments or specific membrane compositions.

To fully characterize these relationships, methodological approaches should include:

  • Multiple sequence alignment of Lgt sequences from diverse bacterial lineages

  • Homology modeling based on available structural data

  • Site-directed mutagenesis of predicted catalytic and substrate-binding residues

  • Biochemical characterization of wild-type and mutant enzymes

What are the critical parameters that affect the stability and activity of recombinant M. silvestris Lgt in vitro?

Several parameters critically influence the stability and activity of recombinant M. silvestris Lgt:

  • pH dependence: Given that M. silvestris grows optimally at pH 5.5 , its Lgt may exhibit maximum activity and stability at acidic pH values compared to Lgt from neutrophilic bacteria. Researchers should test activity across a pH range of 4.5-8.0 to determine the optimal conditions.

  • Detergent composition: The choice of detergent significantly impacts membrane protein stability and function. Systematic screening of detergents (maltoside-based, glucoside-based, zwitterionic, etc.) is essential for optimizing Lgt activity.

  • Lipid requirements: As Lgt functions at the membrane interface and uses phospholipids as substrates, the addition of specific lipids (phosphatidylglycerol, cardiolipin) may enhance enzyme stability and activity.

  • Temperature stability: M. silvestris grows optimally at 25°C , so its Lgt may display different temperature stability profiles compared to enzymes from mesophilic or thermophilic bacteria.

ParameterOptimal RangeEffect on ActivityEffect on Stability
pH5.0-6.0 (predicted)Bell-shaped curve with maximum at optimal pHDecreased stability at extremes
Detergent typeMild detergents (DDM, LMNG)Varies by detergentHigher stability in larger micelles
Lipid additionPG, CL (1-5 mol%)Enhanced activity with native substratesIncreased stability over time
Temperature15-30°C (predicted)Increasing activity up to optimal temperatureRapid inactivation above 35°C

How can researchers effectively troubleshoot expression and purification issues with recombinant M. silvestris Lgt?

When encountering challenges with recombinant M. silvestris Lgt expression and purification, consider this methodological troubleshooting approach:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different expression strains (BL21(DE3), C41/C43(DE3), Rosetta)

    • Vary induction conditions (IPTG concentration, temperature, duration)

    • Consider fusion partners that enhance folding (MBP, SUMO)

    • Evaluate the location of affinity tags (N-terminus vs. C-terminus)

  • Protein aggregation:

    • Lower the expression temperature (16-20°C)

    • Reduce inducer concentration

    • Include chemical chaperones in growth media (glycerol, sorbitol)

    • Test different detergents for solubilization

    • Include stabilizing additives (glycerol, arginine, specific lipids)

  • Poor enzymatic activity:

    • Ensure proper reconstitution with phospholipids

    • Test different detergent-to-protein ratios

    • Verify pH optimum considering M. silvestris' acidophilic nature

    • Evaluate the impact of buffer components on activity

    • Consider using synthetic peptide substrates derived from M. silvestris lipoproteins

  • Protein instability:

    • Identify and optimize buffer conditions (pH, ionic strength, additives)

    • Screen detergent types and concentrations

    • Consider protein stabilization approaches (thermofluor assay-guided optimization)

    • Evaluate storage conditions (temperature, additives, flash freezing vs. slow cooling)

What insights can be gained from studying the inhibition kinetics of M. silvestris Lgt?

Studying the inhibition kinetics of M. silvestris Lgt can provide valuable insights into its mechanism and potential applications:

  • Mechanistic understanding: Inhibitor studies can reveal details about the catalytic mechanism and substrate binding sites. For instance, competitive inhibitors that mimic phosphatidylglycerol or prolipoprotein substrates can help map the binding pockets.

  • Comparative biochemistry: Comparing inhibition profiles of Lgt from M. silvestris with those from other bacterial species (like E. coli Lgt inhibitors described in the literature ) can highlight mechanistic similarities and differences.

  • Structure-activity relationships: Testing series of structurally related inhibitors can provide insights into the molecular features required for binding and inhibition.

  • Potential antibacterial development: While primarily of academic interest for M. silvestris, understanding inhibition mechanisms could aid in developing antibacterials targeting Lgt in pathogenic bacteria, as Lgt inhibition has been shown to increase sensitivity to antibiotics and serum killing .

Methodological approaches should include:

  • Steady-state kinetic analysis with varying inhibitor concentrations

  • Determination of inhibition constants (Ki) and inhibition modes

  • Time-dependent inhibition studies to identify potential covalent inhibitors

  • Thermal shift assays to evaluate inhibitor binding

How does the metabolic versatility of M. silvestris influence the expression and function of its Lgt?

M. silvestris possesses remarkable metabolic versatility, capable of growing on both methane and multicarbon substrates like acetate . This versatility may influence Lgt expression and function in several ways:

  • Differential expression: Lgt expression levels may vary depending on carbon source, as growth on different substrates results in different membrane compositions and growth rates. For example, M. silvestris exhibits higher growth yields and efficiencies on acetate (Yx/m = 20.5 ± 1.24 g dry cell material mol⁻¹ substrate; 40.1 ± 2.43% carbon conversion efficiency) compared to methane (Yx/m = 3.59 ± 0.104; 13.2 ± 0.698% efficiency) .

  • Substrate availability: Different growth substrates affect phospholipid composition, potentially influencing the availability of the phosphatidylglycerol substrate for Lgt.

  • Membrane adaptations: Growth on different carbon sources may lead to changes in membrane fluidity and composition, potentially affecting the activity and substrate specificity of membrane-associated enzymes like Lgt.

To investigate these relationships, researchers should consider:

  • Comparative transcriptomic and proteomic analyses of M. silvestris grown on different carbon sources

  • Lipidomic analysis to determine how carbon source affects phospholipid composition

  • In vitro activity assays using Lgt purified from cells grown on different substrates

  • Evaluation of substrate specificity using phospholipids derived from cells grown under different conditions

Growth SubstrateGrowth Rate (day⁻¹)Biomass Yield (g mol⁻¹)Carbon Conversion (%)Predicted Impact on Lgt
Acetate1.26 ± 0.03520.5 ± 1.2440.1 ± 2.43Potentially higher expression, different phospholipid substrate pool
Methane0.78 ± 0.0533.59 ± 0.10413.2 ± 0.698Potentially lower expression, altered membrane composition

What are the recommended controls for validating the specificity of recombinant M. silvestris Lgt activity assays?

When developing and validating activity assays for recombinant M. silvestris Lgt, include these essential controls:

  • Negative controls:

    • Heat-inactivated enzyme (95°C for 10 minutes)

    • Reaction mixture without enzyme

    • Catalytically inactive mutant (e.g., mutation of predicted catalytic residues)

    • Reaction without phosphatidylglycerol substrate

    • Reaction without peptide substrate

  • Positive controls:

    • Well-characterized Lgt from another species (e.g., E. coli Lgt)

    • Known concentration of the reaction product (glycerol-3-phosphate) for standard curves in coupled assays

  • Specificity controls:

    • Peptide substrate with mutated cysteine (C→A) to confirm the specificity of the modification site

    • Various phospholipid substrates to confirm specificity for phosphatidylglycerol

    • Competition assays with unlabeled substrates

  • System validation:

    • Linearity of signal with enzyme concentration

    • Time-dependence of product formation

    • Reproducibility across multiple enzyme preparations

How can researchers effectively compare the enzymatic properties of M. silvestris Lgt with Lgt from other bacterial species?

To rigorously compare M. silvestris Lgt with Lgt from other species, implement this methodological framework:

  • Standardized expression and purification:

    • Express all Lgt proteins in the same host system

    • Use identical affinity tags and purification protocols

    • Verify comparable purity and oligomeric state

    • Ensure similar detergent/lipid environments

  • Kinetic parameter determination:

    • Determine Km and kcat for the same substrates under identical conditions

    • Establish pH-rate profiles across a range of pH values

    • Measure temperature dependence of activity

    • Evaluate substrate specificity with identical substrate panels

  • Thermodynamic stability:

    • Measure thermal denaturation profiles using differential scanning fluorimetry

    • Determine detergent stability using detergent dilution assays

    • Assess pH-dependent stability

    • Evaluate long-term storage stability under different conditions

  • Structural comparison:

    • Circular dichroism to compare secondary structure content

    • Limited proteolysis to probe domain organization and flexibility

    • If possible, structural determination by X-ray crystallography or cryo-EM

ParameterMeasurement MethodExpected Differences Based on Ecological Niche
pH optimumpH-rate profileLower pH optimum for M. silvestris Lgt compared to neutrophilic bacteria
Temperature optimumTemperature-rate profileLower temperature optimum for M. silvestris compared to mesophilic bacteria
Substrate specificityKinetic analysis with various phospholipidsPotential preference for phospholipids with fatty acid compositions typical of M. silvestris membranes
StabilityThermal shift assayPotentially lower thermal stability but higher acid stability for M. silvestris Lgt

What advanced techniques can be used to study the membrane topology and structure of M. silvestris Lgt?

Several advanced techniques can elucidate the membrane topology and structure of M. silvestris Lgt:

  • Cysteine accessibility methods:

    • Systematic introduction of cysteine residues throughout the protein

    • Selective labeling with membrane-permeable and impermeable reagents

    • Mass spectrometry analysis to determine modification patterns

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Measures protein dynamics and solvent accessibility

    • Can identify membrane-embedded regions and flexible loops

    • Provides insights into conformational changes upon substrate binding

  • Cross-linking mass spectrometry:

    • Application of bifunctional cross-linkers followed by MS analysis

    • Identifies spatial relationships between protein domains

    • Can capture transient interactions with substrates or other proteins

  • Cryo-electron microscopy:

    • Direct visualization of protein structure in near-native conditions

    • May require reconstitution into nanodiscs or amphipols

    • Can potentially capture different conformational states

  • Molecular dynamics simulations:

    • In silico modeling of protein-membrane interactions

    • Prediction of dynamic behavior in lipid bilayers

    • Testing hypotheses about substrate binding and catalytic mechanism

How can researchers address the challenge of substrate specificity in M. silvestris Lgt functional studies?

Addressing substrate specificity challenges in M. silvestris Lgt studies requires a multifaceted approach:

  • Prolipoprotein substrate analysis:

    • Bioinformatic identification of putative lipoproteins in the M. silvestris genome based on lipobox motifs

    • Design of synthetic peptides representing various M. silvestris prolipoprotein signal sequences

    • Comparison of modification efficiency across different peptide substrates

  • Phospholipid substrate analysis:

    • Lipidomic profiling of M. silvestris membrane phospholipids

    • Synthesis or purification of various phospholipid species for activity testing

    • Determination of kinetic parameters for each phospholipid substrate

  • Heterologous substrates:

    • Testing M. silvestris Lgt activity on well-characterized substrates from model organisms (E. coli Pal-IAAC peptide)

    • Comparative analysis of modification efficiency between homologous and heterologous substrates

  • Structure-activity relationships:

    • Systematic mutation of residues in the peptide substrate to map recognition determinants

    • Evaluation of phospholipid structural features (acyl chain length, saturation, head group) on modification efficiency

Substrate TypeAnalysis MethodExpected Outcome
Prolipoprotein peptidesIn vitro modification assayIdentification of optimal signal sequence motifs for M. silvestris Lgt
PhospholipidsKinetic analysisDetermination of preferred phospholipid species and structural features
Heterologous substratesComparative kineticsAssessment of substrate recognition flexibility across bacterial species
Mutant substratesStructure-activity relationshipMapping of critical residues for substrate recognition

How should researchers interpret discrepancies between in vitro and in vivo activity data for recombinant M. silvestris Lgt?

When encountering discrepancies between in vitro and in vivo activity data for recombinant M. silvestris Lgt, consider these methodological approaches to interpretation:

  • Physiological context differences:

    • The membrane environment in vivo differs significantly from detergent micelles in vitro

    • Natural substrate concentrations and accessibility may vary between systems

    • Presence of interacting proteins or regulators in vivo may affect activity

  • Protein modifications and conformation:

    • Post-translational modifications present in vivo may be absent in recombinant systems

    • Detergent solubilization may alter protein conformation compared to native membrane

    • Expression host (E. coli) may process the protein differently than M. silvestris

  • Experimental approaches to reconcile differences:

    • Reconstitute purified enzyme in liposomes mimicking M. silvestris membrane composition

    • Express tagged versions in M. silvestris for direct comparison with heterologous expression

    • Use complementation assays in Lgt-depleted strains to assess functional equivalence

    • Analyze the lipid environment around the enzyme using lipidomics

  • Common methodological pitfalls:

    • Detergent interference with activity assays

    • Substrate accessibility limitations in different systems

    • Protein instability during purification affecting activity measurements

What are the most common pitfalls in interpreting binding kinetics data for M. silvestris Lgt interactions with substrates and inhibitors?

Interpreting binding kinetics data for membrane proteins like M. silvestris Lgt presents several challenges:

  • Detergent interference:

    • Detergents can compete with or alter substrate binding sites

    • Different detergents can result in different apparent binding constants

    • Micelle concentration may affect the actual concentration of available enzyme

  • Two-substrate enzyme considerations:

    • Lgt catalyzes a reaction with two substrates (phosphatidylglycerol and prolipoprotein)

    • Determining the reaction mechanism (sequential vs. ping-pong) requires careful kinetic analysis

    • The order of substrate binding may affect interpretation of inhibition data

  • Data analysis complexities:

    • Non-specific binding to micelles can complicate interpretation

    • Potential cooperativity or allosteric effects may not follow simple Michaelis-Menten kinetics

    • Time-dependent inhibition may be mistaken for tight binding

  • Methodological recommendations:

    • Use multiple measurement techniques to confirm binding constants

    • Consider the impact of detergent concentration on apparent binding parameters

    • Employ global fitting of data sets collected under various conditions

    • Validate binding using orthogonal methods (thermal shift assays, HDX-MS)

How can researchers effectively evaluate the impact of M. silvestris Lgt mutations on enzyme function and bacterial physiology?

To comprehensively evaluate the impact of M. silvestris Lgt mutations, implement this methodological framework:

  • In vitro mutational analysis:

    • Generate site-directed mutants of conserved residues identified through sequence alignment

    • Express and purify mutant proteins using protocols identical to wild-type

    • Determine kinetic parameters (Km, kcat) for each mutant

    • Assess protein stability using thermal shift assays and limited proteolysis

  • Structural impact assessment:

    • Use circular dichroism to evaluate changes in secondary structure

    • If available, determine structures of key mutants by X-ray crystallography or cryo-EM

    • Perform molecular dynamics simulations to predict structural perturbations

  • In vivo complementation studies:

    • Express mutant versions in Lgt-depleted strains to assess functional complementation

    • Evaluate growth rates, membrane integrity, and stress resistance

    • Analyze accumulation of unprocessed prolipoproteins by Western blotting

  • Physiological impact analysis:

    • Assess membrane permeability using fluorescent dyes

    • Determine antibiotic sensitivity profiles

    • Evaluate serum resistance if relevant to the organism's ecology

Mutation TypeExpected In Vitro EffectExpected In Vivo EffectDetection Method
Catalytic residuesDramatic decrease in kcatGrowth defects, accumulation of unprocessed prolipoproteinsActivity assays, Western blotting
Substrate bindingIncreased KmPartial complementation, slower growthKinetic analysis, growth curves
Structural stabilizationDecreased thermal stabilityTemperature-sensitive phenotypeThermal shift assay, growth at various temperatures
Membrane interactionAltered detergent sensitivityMembrane integrity issuesDetergent stability assays, membrane permeability tests

What emerging technologies hold promise for advancing our understanding of M. silvestris Lgt structure and function?

Several cutting-edge technologies show potential for deepening our understanding of M. silvestris Lgt:

  • Single-particle cryo-electron microscopy:

    • Recent advances enable structure determination of smaller membrane proteins

    • Can capture different conformational states during the catalytic cycle

    • May reveal substrate binding pockets and catalytic machinery

  • Native mass spectrometry:

    • Allows analysis of intact membrane protein complexes with bound lipids

    • Can provide insights into oligomeric state and protein-lipid interactions

    • May detect conformational changes upon substrate binding

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, cryo-EM, SAXS, and computational modeling

    • Creates comprehensive structural models by integrating multiple data sources

    • Particularly valuable for membrane proteins resistant to crystallization

  • AlphaFold2 and other AI-based structure prediction:

    • Can generate highly accurate structural models even for membrane proteins

    • Useful for generating hypotheses about catalytic mechanism

    • May guide mutagenesis experiments and inhibitor design

  • Time-resolved spectroscopy:

    • Captures transient intermediates in the catalytic cycle

    • Can provide insights into reaction mechanism and rate-limiting steps

    • Applicable when combined with fluorescent or chromogenic substrate analogs

What are the potential applications of understanding M. silvestris Lgt in broader microbiological and biotechnological contexts?

Understanding M. silvestris Lgt has several potential applications:

  • Antimicrobial development:

    • Insights from M. silvestris Lgt can inform the design of inhibitors targeting Lgt in pathogenic bacteria

    • Lgt inhibition increases bacterial sensitivity to antibiotics and serum killing

    • Understanding resistance mechanisms to Lgt inhibition can guide drug development strategies

  • Synthetic biology applications:

    • Engineering lipoproteins for surface display of enzymes or binding proteins

    • Developing controlled lipoprotein modification systems for biotechnological applications

    • Creating chimeric Lgt enzymes with novel substrate specificities

  • Methanotrophic bacteria engineering:

    • Understanding membrane protein biogenesis in M. silvestris could facilitate engineering of methanotrophs for enhanced methane utilization

    • M. silvestris' unique metabolic versatility makes it an attractive platform for methane bioconversion

    • Enhancing membrane integrity through optimized lipoprotein processing could improve stress tolerance

  • Environmental applications:

    • Insights into M. silvestris physiology could improve bioremediation strategies using methanotrophic bacteria

    • Understanding cold adaptation of Lgt may be relevant for environmental applications in temperate environments

    • Knowledge of lipoprotein processing may help optimize M. silvestris for methane capture applications

How might comparative analysis of Lgt across different methanotrophic bacteria reveal evolutionary adaptations to diverse ecological niches?

Comparative analysis of Lgt across methanotrophic bacteria can reveal important evolutionary insights:

  • Ecological adaptation signatures:

    • Comparison between obligate methanotrophs and facultative methanotrophs like M. silvestris

    • Analysis of Lgt from acidophilic (M. silvestris) versus neutrophilic methanotrophs

    • Examination of cold-adapted methanotrophs versus mesophilic species

  • Substrate specificity evolution:

    • Differences in lipobox recognition motifs across methanotrophic lineages

    • Variations in phospholipid substrate preference reflecting membrane composition

    • Evolution of catalytic residues and binding pockets

  • Methodological approaches:

    • Phylogenetic analysis of Lgt sequences from diverse methanotrophs

    • Biochemical characterization of Lgt from representative species

    • Complementation studies to assess functional conservation

    • Structural comparison through homology modeling or experimental structure determination

  • Expected adaptations:

    • pH-dependent activity profiles aligned with organism's optimal growth pH

    • Temperature stability reflecting the thermal environment of the organism

    • Substrate specificity tuned to the membrane composition of each species

This comparative approach would not only reveal evolutionary adaptations but also provide insights into the fundamental mechanisms of membrane protein function across diverse bacterial lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.