Recombinant Methylococcus capsulatus Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Introduction to Apolipoprotein N-acyltransferase

Apolipoprotein N-acyltransferase (Lnt) plays a critical role in bacterial lipoprotein maturation, a sophisticated post-translational modification process. Lipoproteins serve as essential components of bacterial cell envelopes and contribute to numerous vital cellular functions. The maturation of these proteins involves the covalent attachment of lipids through a sequential three-step process controlled by three distinct integral membrane enzymes . The final step in this process, unique to Gram-negative bacteria, is the N-acylation of the terminal cysteine residue by Lnt, which results in the formation of the mature lipoprotein .

Based on sequence similarity analysis, Lnt belongs to the nitrilase superfamily, characterized by proteins containing a common Glu-Lys-Cys catalytic triad that hydrolyzes carbon-nitrogen bonds . In the specific case of Lnt, the nitrilase domain catalyzes the attachment of a phospholipid to the alpha-amino group of the N-terminal cysteine of the apolipoprotein, creating the final mature lipoprotein. This attachment proceeds via a proposed two-step ping-pong mechanism . The first step involves the acyl transfer of the phospholipid substrate to create a thioester linkage on the active site cysteine. The second step entails the transfer of the acyl chain from this cysteine to the N-terminal cysteine of the apolipoprotein .

The importance of Lnt extends beyond its catalytic function. All three enzymes involved in lipid attachment are essential for survival in bacteria, making them attractive targets for new antimicrobial agents . Recent research has expanded our understanding of Lnt's distribution across bacterial species, with the identification of Lnt activity not only in Gram-negative bacteria but also in Gram-positive mycobacteria , challenging previous assumptions about lipoprotein processing in different bacterial groups.

Methylococcus capsulatus as a Source Organism

Methylococcus capsulatus represents a fascinating bacterium with unique metabolic capabilities that make it an interesting source for the study of Lnt enzymes. This organism is classified as a methanotrophic bacterium, meaning it utilizes methane as its primary carbon and energy source . Particularly notable is the strain Bath, which has been extensively studied for its metabolic versatility and environmental significance.

M. capsulatus shares remarkable physiological characteristics with ammonia-oxidizing bacteria, primarily stemming from its ability to initiate the oxidation of both methane and ammonia . Both M. capsulatus and ammonia-oxidizing bacteria carry out the first step of nitrification, the oxidation of ammonia to nitrite, through the intermediate hydroxylamine . This metabolic flexibility highlights the sophisticated biochemical machinery present in this organism, which may influence the properties and functions of its enzymes, including Apolipoprotein N-acyltransferase.

The genomic analysis of M. capsulatus has revealed interesting features related to nitrogen metabolism. Initially, researchers thought that M. capsulatus oxidized hydroxylamine with cytochrome P460 (encoded by the cytL gene), until the discovery of a hydroxylamine oxidoreductase (hao) gene in its genome . This finding established further metabolic parallels between M. capsulatus and ammonia-oxidizing bacteria, suggesting evolutionary conservation of certain biochemical pathways.

The environmental significance of M. capsulatus extends to its role in global methane cycling and potential applications in bioremediation and industrial processes. Understanding the molecular machinery of this organism, including enzymes like Lnt that are essential for cellular function, contributes to our broader knowledge of bacterial adaptation and metabolic diversity.

Recombinant Production of Methylococcus capsulatus Lnt

The recombinant form of Methylococcus capsulatus Apolipoprotein N-acyltransferase is produced through heterologous expression in Escherichia coli expression systems. The recombinant protein encompasses the full-length sequence (amino acids 1-504) and is engineered with an N-terminal histidine tag to facilitate purification through affinity chromatography techniques .

The production of recombinant M. capsulatus Lnt involves careful optimization of expression conditions to ensure proper folding and functional integrity of this membrane-associated enzyme. The purified protein is typically supplied as a lyophilized powder with a purity greater than 90% as determined by SDS-PAGE analysis . This high-purity preparation ensures reliable results in subsequent biochemical and structural studies.

For optimal handling and storage of the recombinant protein, specific conditions have been established. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, the addition of glycerol to a final concentration of 5-50% is recommended, with the default concentration being 50% . The reconstituted protein should be stored at -20°C/-80°C, and repeated freeze-thaw cycles should be avoided to maintain protein stability and activity .

Functional Properties and Mechanism of Action

The Apolipoprotein N-acyltransferase from Methylococcus capsulatus functions as a critical enzyme in bacterial lipoprotein maturation. Its primary role involves catalyzing the N-acylation of the alpha-amino group of the N-terminal cysteine of apolipoproteins, converting them to mature lipoproteins. This post-translational modification is essential for proper lipoprotein localization and function within the bacterial cell envelope.

The catalytic mechanism of Lnt involves a sophisticated two-step ping-pong reaction that reflects its membership in the nitrilase superfamily. In the first step, a phospholipid substrate is bound in the active site, and an acyl chain is transferred to the active site cysteine, forming a thioester acyl-intermediate . This covalent modification at the active site cysteine is consistent with observations in crystal structures of Lnt proteins . In the second step, the incoming apolipoprotein substrate interacts with the enzyme, and the acyl chain is transferred from the enzyme's active site to the N-terminal cysteine of the apolipoprotein .

A distinctive feature of the Lnt catalytic mechanism involves the movement of essential residues triggered by substrate binding. Studies of E. coli Lnt have identified a critical tryptophan residue (W237) that plays a key role in controlling active site access and substrate interactions . This residue can adopt different conformations: an upward position interacting with T271 and pointing away from the substrate portal when no substrates are present, or a downward position pointing into the substrate portal when coordinated with potential substrates (either protein or lipid) . This conformational switch appears to be triggered by substrate binding and potentially initiates catalysis.

The substrate specificity of Lnt has been investigated in various bacterial systems. In mycobacteria, the substrate for N-acylation has been identified as a C16 fatty acid, while the diacylglycerol modification involves C16 and C19:0 fatty acids (the latter likely being tuberculostearic acid) . This specific acylation pattern contributes to the distinctive properties of bacterial lipoproteins and may vary between different bacterial species. The exact substrate preferences of M. capsulatus Lnt would require specific experimental determination, but the conservation of the catalytic machinery suggests similar mechanistic principles.

Applications and Research Significance

Recombinant Methylococcus capsulatus Apolipoprotein N-acyltransferase holds substantial significance in various research applications, ranging from fundamental biochemical studies to applied biotechnology and drug discovery. As an essential enzyme involved in bacterial lipoprotein maturation, it represents a valuable model system for understanding post-translational modification processes in bacteria.

The availability of purified recombinant M. capsulatus Lnt facilitates detailed biochemical and structural investigations to elucidate the mechanism of lipoprotein maturation in this methanotrophic bacterium. Such studies can provide insights into the unique aspects of lipoprotein processing in bacteria with specialized metabolic capabilities, such as methane oxidation. Comparative analyses with Lnt enzymes from other bacterial species can reveal evolutionary adaptations and specialized functions that may have arisen in different bacterial lineages.

From a therapeutic perspective, Lnt represents a promising target for antimicrobial development. All three enzymes involved in lipid attachment to bacterial lipoproteins—Lgt, LspA, and Lnt—are essential for bacterial survival, making them attractive candidates for new antimicrobial agents . The fact that Lnt is conserved across diverse bacterial species but absent in humans further enhances its appeal as a drug target. The recombinant protein provides a valuable tool for high-throughput screening assays to identify potential inhibitors that could be developed into novel antibiotics.

Furthermore, studies of Lnt contribute to our fundamental understanding of bacterial physiology and the essential processes that support bacterial survival and adaptation. Recent research has demonstrated that mycobacterial lipoproteins are triacylated, with Lnt activity identified in Gram-positive mycobacteria, challenging previous assumptions about lipoprotein processing in different bacterial groups . This finding exemplifies how research on enzymes like Lnt can lead to paradigm shifts in our understanding of bacterial biology.

Future Research Directions

The investigation of Methylococcus capsulatus Apolipoprotein N-acyltransferase opens numerous avenues for future research that could significantly expand our understanding of bacterial lipoprotein processing and develop novel antimicrobial strategies. Several promising directions merit particular attention from researchers in the field.

Detailed structural analysis of M. capsulatus Lnt remains a priority for future studies. While crystal structures of Lnt from other bacteria provide valuable insights, determination of the three-dimensional structure of M. capsulatus Lnt through X-ray crystallography or cryo-electron microscopy would reveal any unique features that may distinguish it from other Lnt enzymes. Capturing the enzyme in different conformational states, particularly with bound substrates or inhibitors, would further elucidate the dynamic aspects of its catalytic mechanism.

Investigation of substrate specificity represents another important research direction. Determining the preferences of M. capsulatus Lnt for acyl donors and the structural requirements for apolipoprotein substrates would enhance our understanding of lipoprotein maturation in this organism. Comparative studies with Lnt enzymes from diverse bacterial species could reveal evolutionary adaptations in substrate recognition and catalytic mechanism that may correlate with the ecological niches occupied by different bacteria.

The development of specific inhibitors targeting Lnt constitutes a promising approach for antimicrobial discovery. Structure-guided drug design utilizing the recombinant enzyme could lead to the identification of compounds that selectively inhibit its activity, potentially providing new tools to combat bacterial infections. The essential nature of Lnt for bacterial survival underscores the therapeutic potential of such inhibitors. Testing candidate inhibitors against Lnt enzymes from various pathogenic bacteria would help assess their broad-spectrum potential and guide optimization efforts.

Exploring the physiological role of lipoproteins in the context of the unique metabolism of M. capsulatus represents a fascinating area for future research. Investigating how lipoprotein function integrates with methane oxidation pathways could reveal novel regulatory mechanisms and metabolic interconnections. Such studies would contribute to our understanding of bacterial adaptation to specialized ecological niches and potentially uncover new biotechnological applications for methanotrophic bacteria.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnt; MCA1455; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-504
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
lnt
Target Protein Sequence
MKAMLLALTGGILLPFAFAPFGYALVAPLSLALLFRVWLNASPSKAALYGYLFGLGQFGI GVSWVFVSMYEYGGSDVFSAAGLTALFVAYLALFPALAGWLGVKAGGGSILVRTLLVFPA AWVVTEWLRGWLFSGFPWLQIGYSQTDTGLRSIAPVFGVFGVGWLLAVLAGLLLSAWLLD RRGRRFALLGAAVVLVGSTQFAKVQWTHPAGDPIRVTLLQGNVPQDQKWRPEAKTTTVQM YVDMTRQHWDSRLIIWPETAVPAFYQQVAESFLAPLEAEARQHGVDVLVGVPYYEAQGNR YYNALVTLGAKPGRYFKRHLVPFGEFLPLRPVLAFVLDILQIPLADFTAGAHRQTLLQAA GYPLIASICYEDIFGQESLTGLPEGAYLVNVTNDAWFGDSFAPHQHWQKARMRALETGRY MLRATNTGVTGIIDAGGRPVAVAPMFEREALTGMMQPMAGATPYALWGDWPAIGLCAGIV GICFARRRRNASSHQGRQAEPGRN
Uniprot No.

Target Background

Function
Catalyzes the phospholipid dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links

KEGG: mca:MCA1455

STRING: 243233.MCA1455

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) in Methylococcus capsulatus?

Apolipoprotein N-acyltransferase (lnt) in Methylococcus capsulatus is an integral membrane enzyme that catalyzes the final step in bacterial lipoprotein maturation. It belongs to the nitrilase superfamily, which contains proteins characterized by a conserved Glu-Lys-Cys catalytic triad that hydrolyzes carbon-nitrogen bonds . In Gram-negative bacteria like M. capsulatus, lnt is essential for survival as it performs the N-acylation of the terminal cysteine in apolipoproteins to form mature lipoproteins . This post-translational modification is crucial for the proper functioning of bacterial lipoproteins, which are key components of the cell envelope and responsible for many essential cellular functions .

How should recombinant Methylococcus capsulatus lnt be stored for optimal stability?

For optimal stability, recombinant Methylococcus capsulatus lnt should be stored according to the following guidelines:

  • Upon receipt, the lyophilized protein should be stored at -20°C to -80°C

  • For long-term storage, the reconstituted protein should be aliquoted and stored at -20°C or -80°C with 5-50% glycerol (with 50% being the typical recommendation)

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freeze-thaw cycles should be avoided as they may compromise protein stability and activity

For reconstitution, it is recommended to centrifuge the vial briefly before opening to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What is the proposed catalytic mechanism of Methylococcus capsulatus lnt?

The catalytic mechanism of Methylococcus capsulatus lnt, like other bacterial Apolipoprotein N-acyltransferases, is proposed to follow a two-step ping-pong mechanism:

  • First step (Acylation): The enzyme transfers an acyl chain from a phospholipid substrate to the active site cysteine residue within the Glu-Lys-Cys catalytic triad, forming a thioester intermediate .

  • Second step (Transfer): The acyl chain is subsequently transferred from the enzyme's active site cysteine to the N-terminal cysteine of the apolipoprotein substrate, completing the maturation of the lipoprotein .

This mechanism involves significant conformational changes in the enzyme structure. Crystal structures of the enzyme have revealed at least two distinct conformational states: one showing the thioester acyl-intermediate bound to the active site cysteine, and another representing an apparent apo-state with an open substrate entry portal .

How do conformational changes in lnt affect its function?

Conformational changes play a crucial role in lnt function during the catalytic cycle. Based on crystallographic studies of lnt:

  • The enzyme exhibits at least two distinct conformational states corresponding to different stages of the catalytic cycle .

  • A key residue, W237, undergoes significant movement that appears to be triggered by substrate binding .

  • This movement of W237 likely helps direct and stabilize the interaction between lnt and the incoming apolipoprotein substrate .

  • One crystal form revealed two molecules in the asymmetric unit - one showing the thioester acyl-intermediate and another suggesting a potential mode of apolipoprotein docking .

  • Another crystal form showed a remarkably open substrate entry portal, completely devoid of bound molecules, representing a potential apo-state .

These structural insights suggest that lnt undergoes dynamic conformational changes to accommodate its substrates and facilitate the two-step catalytic mechanism. Understanding these changes is important for researchers studying enzyme mechanism and for those interested in developing inhibitors of lnt as potential antimicrobial agents.

What expression systems are most effective for producing recombinant Methylococcus capsulatus lnt?

For the effective expression of recombinant Methylococcus capsulatus Apolipoprotein N-acyltransferase (lnt), Escherichia coli-based expression systems have proven successful. Based on available research:

  • Expression host: E. coli has been demonstrated as an effective host for the heterologous expression of M. capsulatus lnt .

  • Vector system: For membrane proteins like lnt, vectors with controllable expression are recommended, often utilizing the T7 promoter system or similar inducible promoters.

  • Fusion tags: N-terminal His-tag fusion has been successfully employed for M. capsulatus lnt, facilitating subsequent purification steps .

  • Growth conditions: When expressing M. capsulatus proteins in E. coli, cultivation is typically performed in standard LB medium at 37°C with appropriate antibiotic selection .

  • Induction parameters: For membrane proteins like lnt, lower induction temperatures (16-25°C) and reduced inducer concentrations often yield better results by allowing slower protein production and proper membrane insertion.

How can researchers purify recombinant Methylococcus capsulatus lnt while maintaining activity?

Purification of membrane proteins like lnt requires careful consideration to maintain structural integrity and enzymatic activity. A recommended purification protocol would include:

  • Cell lysis: Use gentle methods such as enzymatic lysis (lysozyme) combined with mild detergents rather than harsh sonication.

  • Membrane isolation: Separate membranes by ultracentrifugation following low-speed centrifugation to remove cell debris.

  • Detergent solubilization: Select mild detergents (e.g., DDM, LMNG, or CHAPS) that effectively solubilize lnt without denaturing it.

  • Affinity chromatography: For His-tagged lnt, use immobilized metal affinity chromatography (IMAC) with Ni-NTA or similar matrices .

  • Buffer optimization: Include glycerol (5-10%) and potentially lipids in purification buffers to stabilize the membrane protein.

  • Purity assessment: Validate purity using SDS-PAGE, aiming for >90% purity as reported for commercial preparations .

  • Storage formulation: The final buffer should contain stabilizing agents; for lnt, a Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been used successfully .

For long-term storage, add glycerol to a final concentration of 50% and store in small aliquots at -80°C to avoid repeated freeze-thaw cycles .

How can CRISPR/Cas9 systems be adapted for editing the lnt gene in Methylococcus capsulatus?

Implementing CRISPR/Cas9 gene editing for the lnt gene in Methylococcus capsulatus requires specific adaptations for this bacterium:

  • Delivery system: Conjugation using broad-host-range expression plasmids has been successfully demonstrated for delivering CRISPR components to M. capsulatus. Specifically, E. coli S17-1 cells can be used for biparental mating on NMS mating agar .

  • CRISPR components: The system requires:

    • Streptococcus pyogenes Cas9 endonuclease expressed heterologously

    • A synthetic single guide RNA (gRNA) designed to target the lnt gene

    • A repair template for homology-directed repair if specific mutations are desired

  • Expression control: Regulated expression using inducible systems (such as anhydrotetracycline-inducible promoters) can help control Cas9 expression levels, which is important since efficient Cas9 targeting in M. capsulatus can result in cell death due to double-stranded DNA cleavage .

  • Culture conditions: Prior to conjugation, M. capsulatus cells should be cultured at 37°C in a controlled atmosphere containing 20% (vol/vol) methane in air .

  • Verification strategies: Successful editing can be verified through sequencing analysis of PCR amplicons from the targeted region .

  • Functional validation: For lnt mutations, functional effects could be assessed by examining lipoprotein processing and cellular phenotypes related to membrane integrity.

Why might recombinant Methylococcus capsulatus lnt show reduced activity after purification?

Several factors can contribute to reduced activity of purified recombinant M. capsulatus lnt:

  • Detergent effects: As an integral membrane protein, lnt requires a lipid-like environment. Harsh detergents can strip essential lipids and disrupt the protein's structure. Consider:

    • Using milder detergents like DDM or LMNG

    • Adding phospholipids to the purification buffer to stabilize the protein

    • Exploring nanodiscs or liposome reconstitution for activity assays

  • Loss of essential cofactors: The nitrilase domain of lnt contains a catalytic Glu-Lys-Cys triad, and the cysteine residue is particularly susceptible to oxidation . Include reducing agents like DTT or β-mercaptoethanol in buffers to maintain the active site in a reduced state.

  • Conformational constraints: Crystal structures have revealed that lnt undergoes significant conformational changes during catalysis, particularly involving residue W237 . The purification process may trap the enzyme in a non-optimal conformation. Varying buffer conditions may help restore conformational flexibility.

  • Substrate availability: The ping-pong mechanism requires both phospholipid and apolipoprotein substrates . In assays, ensure both substrates are presented in an accessible manner, possibly through liposome incorporation of the enzyme.

What methods can be used to assess the activity of recombinant Methylococcus capsulatus lnt?

Assessing the enzymatic activity of recombinant M. capsulatus lnt requires methods that can detect one or both steps of its ping-pong mechanism:

  • Thioester intermediate formation assay:

    • Incubate purified lnt with phospholipid substrates

    • Detect the acyl-enzyme intermediate using mass spectrometry

    • Alternatively, use radiolabeled phospholipids and monitor transfer to the enzyme by autoradiography

  • Complete N-acylation assay:

    • Provide both phospholipid donor and apolipoprotein acceptor substrates

    • Use synthetic peptides containing the N-terminal cysteine of target lipoproteins

    • Detect product formation by mass spectrometry or HPLC

  • In vivo complementation:

    • Express M. capsulatus lnt in an E. coli lnt conditional mutant

    • Assess restoration of lipoprotein processing by Western blot analysis

    • Monitor rescue of growth phenotypes under restrictive conditions

  • Fluorescence-based assays:

    • Develop FRET-based peptide substrates that change fluorescence properties upon N-acylation

    • Monitor reaction kinetics in real-time using fluorescence spectroscopy

Assay TypeAdvantagesLimitationsKey Controls
Thioester intermediate detectionDirectly measures first stepDoesn't confirm complete reactionCatalytic cysteine mutant (negative control)
Complete N-acylation assayMeasures full enzymatic activityMore complex setupHeat-inactivated enzyme; reaction without phospholipid
In vivo complementationDemonstrates physiological functionIndirect measure of activityEmpty vector; known active lnt variant
Fluorescence-based assaysReal-time kinetics; high sensitivityRequires specialized substrate designNo-enzyme control; substrate-only baseline

How might inhibition of lnt in Methylococcus capsulatus inform antimicrobial development?

As lnt is essential for survival in Gram-negative bacteria, it represents a promising target for novel antimicrobial development . Research on M. capsulatus lnt inhibition could inform antimicrobial strategies in several ways:

  • M. capsulatus provides a non-pathogenic model system to understand the basic biology and inhibition of a conserved bacterial process. Insights gained may be applicable to pathogenic Gram-negative bacteria where lnt is also essential.

  • Structural studies of M. capsulatus lnt have revealed conformational changes during catalysis, particularly involving residue W237 . These mechanistic insights could guide rational design of inhibitors targeting specific conformational states.

  • The ping-pong mechanism offers multiple points for inhibition:

    • Competitive inhibitors of the phospholipid binding site

    • Molecules that covalently modify the catalytic cysteine

    • Compounds that interfere with apolipoprotein substrate binding

    • Inhibitors that lock the enzyme in non-productive conformational states

  • Since the enzymes involved in lipoprotein processing (including lnt) are absent in humans, they represent attractive targets for selective toxicity .

  • Cross-species comparative studies between M. capsulatus lnt and homologs from pathogenic bacteria could identify conserved features for broad-spectrum targeting or unique aspects for species-specific inhibition.

What are the key experimental considerations for determining substrate specificity of Methylococcus capsulatus lnt?

Understanding the substrate specificity of M. capsulatus lnt requires systematic investigation of both its phospholipid donors and apolipoprotein acceptors:

  • Phospholipid donor specificity:

    • Test various phospholipids with different head groups and acyl chain compositions

    • Consider using lipidomic analysis of M. capsulatus membranes to identify natural substrates

    • Employ synthetic phospholipid analogs with reporter groups for high-throughput screening

  • Apolipoprotein acceptor specificity:

    • Analyze the consensus sequence around the lipidated cysteine in M. capsulatus lipoproteins

    • Create a library of synthetic peptides with variations in amino acid composition flanking the N-terminal cysteine

    • Use bioinformatic prediction to identify putative lipoproteins in M. capsulatus and test selected candidates

  • Structural basis of specificity:

    • Use site-directed mutagenesis to modify residues in the predicted substrate binding pockets

    • Employ computational docking to model interactions with various substrates

    • Consider X-ray crystallography with substrate analogs to visualize binding modes

  • Environmental effects on specificity:

    • Investigate how temperature affects substrate preference (relevant for M. capsulatus which grows optimally at 45°C)

    • Examine effects of membrane composition on enzyme activity and selectivity

    • Test how pH and ionic conditions influence substrate recognition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.