Recombinant Methylococcus capsulatus ATP synthase subunit a 1 (atpB1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant atpB1

The ATP synthase subunit a 1 (encoded by atpB1) is a 259-amino acid transmembrane protein (UniProt ID: Q60CS0) responsible for proton translocation during ATP synthesis . Key features include:

PropertyDetail
Expression SystemEscherichia coli with N-terminal His-tag for purification
Molecular Weight~30 kDa (calculated)
Structural DomainsSix transmembrane helices, conserved proton translocation motifs
Gene LocalizationChromosomal; part of the atpBEFHAGDC operon

This subunit forms the membrane-embedded FO sector of ATP synthase, facilitating proton gradient-driven rotation crucial for ATP production .

Functional Role in Methanotrophic Metabolism

ATP synthase in M. capsulatus is integral to its methane-driven energy cycle:

  • Energy Coupling: Converts proton motive force (PMF) from methane oxidation into ATP, supporting RuMP (ribulose monophosphate) and CBB (Calvin-Benson-Bassham) pathways .

  • Thermotolerance: Structural stability of ATP synthase contributes to growth at up to 50°C, a trait linked to intracytoplasmic membrane organization .

  • Nitrogen Assimilation: Transcriptional upregulation of ATP synthase genes under ammonium metabolism correlates with enhanced ATP yield .

Comparative genomic studies reveal atpB1 conservation across Methylococcus strains, though accessory metabolic pathways (e.g., phosphoketolase) vary .

Recombinant Expression

  • Yield Optimization: Codon-optimized atpB1 cloned into pMHA201 vector achieves soluble expression in E. coli .

  • Purification: Nickel-affinity chromatography yields >90% purity, confirmed via SDS-PAGE .

Biotechnological Potential

  • Single-Cell Protein (SCP): ATP synthase efficiency directly impacts biomass yield in industrial SCP production .

  • Metabolic Engineering: Enhanced ATP supply in recombinant M. capsulatus strains improves succinic acid titers by >50% .

  • Environmental Remediation: ATP synthase activity supports methane-to-CO₂ oxidation, mitigating greenhouse gas emissions .

Research Challenges and Innovations

  • Membrane Integration: Heterologous expression in E. coli often results in improper folding; chaperone co-expression improves functionality .

  • Electron Transport Variability: Strains like M. capsulatus Bath exhibit reverse electron transfer inefficiencies compared to M. buryatense, affecting ATP synthase kinetics .

  • CRISPR/Cas9 Editing: Recent tools enable targeted atpB1 modifications to study proton translocation mechanisms .

Future Directions

  • Structural Biology: Cryo-EM studies of recombinant atpB1 could reveal thermostability mechanisms .

  • Synthetic Biology: Modular ATP synthase designs may enhance carbon flux in methane-based biorefineries .

  • Nitrogen Source Synergy: Ammonium-induced ATP synthase upregulation suggests pathways for nitrogen-dependent bioprocess optimization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB1; MCA0006; ATP synthase subunit a 1; ATP synthase F0 sector subunit a 1; F-ATPase subunit 6 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
atpB1
Target Protein Sequence
MATEAHDAGGATGYIVHHLTPLSSGEGFWTLHVDTLFFSVFLGAVFLFFFRKAAEQATAG VPGPFQNFVEMIVEFVDTQVKDSFHGRNALIAPLALSIFAWVFLMNAMDLLPVDLLPDVG KAIGLEYLRVVPSTDLNATFGMSISVFFLIIFYSLKVKGPGHFAMEFLFHPFSHWALVPF NLLLNTVEYLAKPVSLGLRLFGNMYAGELIFILIALLPWWVQPALSFPWAVFHILIITLQ AFIFMVLTIVYLSLAHESH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links

KEGG: mca:MCA0006

STRING: 243233.MCA0006

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a 1 (atpB1) in Methylococcus capsulatus and how does it function?

ATP synthase subunit a 1 (atpB1) is a membrane-embedded component of the F0 sector of ATP synthase in Methylococcus capsulatus. It forms part of the proton channel that couples proton translocation to ATP synthesis. ATP synthase functions as a molecular machine that catalyzes the formation of adenosine triphosphate (ATP) using adenosine diphosphate (ADP) and inorganic phosphate (Pi) . In M. capsulatus, this enzyme plays a critical role in energy metabolism, particularly in relation to its methanotrophic lifestyle where methane is oxidized as a primary energy source .

The function of atpB1 specifically involves forming part of the membrane-embedded proton channel, allowing H+ ions to flow down their concentration gradient, which drives the rotation of the central stalk and enables ATP synthesis in the catalytic F1 domain.

How does recombinant expression of M. capsulatus atpB1 differ from expression of related ATP synthase subunits?

Recombinant expression of M. capsulatus atpB1 presents unique challenges compared to other ATP synthase subunits due to its hydrophobic nature and membrane association. Based on expression protocols for similar proteins, successful strategies typically involve:

Expression ParameteratpB1Soluble F1 SubunitsatpB2
Expression SystemE. coliE. coliE. coli
Optimal VectorpET with His-tagVarious expression vectorspET with His-tag
Special ConsiderationsMembrane protein folding issuesRelatively straightforwardSimilar membrane protein challenges
Detergent RequirementsCritical for solubilizationNot requiredCritical for solubilization
Typical YieldLowerHigherDocumented successful expression

For recombinant atpB1 expression, researchers should consider using specialized E. coli strains (like C41/C43) designed for membrane protein expression, lower induction temperatures (16-20°C), and careful optimization of detergent types for solubilization and purification.

What are the optimal purification strategies for recombinant M. capsulatus atpB1?

Purification of recombinant M. capsulatus atpB1 requires specialized approaches due to its hydrophobic nature. Based on successful protocols for similar membrane proteins and atpB2, the following methodological strategy is recommended:

  • Initial Preparation:

    • After expression, centrifuge bacterial cultures at 6,000g for 10 minutes at 4°C

    • Resuspend pellet in lysis buffer containing protease inhibitors

    • Perform cell disruption via sonication or French press

  • Membrane Isolation:

    • Centrifuge lysate at 10,000g for 20 minutes to remove cell debris

    • Ultracentrifuge supernatant at 100,000g for 1 hour to pellet membranes

    • Resuspend membrane fraction in solubilization buffer

  • Protein Solubilization:

    • Use a suitable detergent mixture (e.g., 1% n-Dodecyl β-D-maltoside or CHAPS)

    • Incubate at 4°C for 1-2 hours with gentle rotation

    • Ultracentrifuge at 100,000g for 30 minutes to remove insoluble material

  • Affinity Chromatography:

    • Apply solubilized fraction to Ni-NTA resin (for His-tagged protein)

    • Wash extensively with buffers containing low imidazole concentrations

    • Elute with buffer containing 250-300 mM imidazole

  • Further Purification:

    • Perform size exclusion chromatography to enhance purity

    • Consider ion exchange chromatography as a polishing step

    • Concentrate using 30 kDa MWCO concentrators

Purification StepBuffer CompositionCritical ParametersExpected Results
Membrane Isolation50 mM Tris-HCl pH 8.0, 100 mM NaClTemperature (4°C)Enriched membrane fraction
SolubilizationAbove buffer + 1% DDM/CHAPSDetergent:protein ratioSolubilized membrane proteins
Ni-NTAAbove buffer + 0.05% DDM + 20-300 mM imidazoleFlow rate, imidazole gradient>90% purity
Size Exclusion50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.02% DDMColumn selectionHomogeneous protein preparation

The purified protein should be stored with 5-50% glycerol at -20°C/-80°C to prevent freeze-thaw damage, similar to the storage conditions recommended for atpB2 .

How can site-directed mutagenesis be used to study the function of atpB1 in M. capsulatus?

Site-directed mutagenesis is a powerful approach to elucidate the structure-function relationships of atpB1. Based on research on related ATP synthase subunits, the following methodological approach is recommended:

  • Target Selection:

    • Focus on conserved charged residues likely involved in proton translocation

    • Identify residues at subunit interfaces that may affect assembly

    • Consider residues in predicted transmembrane helices

  • Mutagenesis Strategy:

    • Design primers with desired mutations using overlap extension PCR

    • Employ the QuikChange method for simple substitutions

    • For multiple mutations, consider Gibson Assembly approaches

  • Functional Analysis:

    • Express wild-type and mutant proteins in parallel

    • Reconstitute proteins into liposomes to measure proton translocation

    • Assess ATP synthesis/hydrolysis rates using coupled enzyme assays

  • Key Residues to Target:
    Based on studies of related ATP synthases, the following types of residues may be critical:

    • Conserved arginine residues (similar to R88 in subunit F which affects ATP hydrolysis)

    • Conserved serine residues (similar to S84 in subunit F)

    • Acidic residues in transmembrane regions that may participate in proton translocation

This approach can reveal how specific residues contribute to:

What role does atpB1 play in the energy metabolism of M. capsulatus in the context of methane oxidation?

M. capsulatus is a methanotrophic bacterium that utilizes methane as its primary carbon and energy source through oxidation pathways . ATP synthase, including the atpB1 subunit, plays a critical role in this process by coupling the proton gradient generated during methane oxidation to ATP synthesis.

The interconnection between methane metabolism and ATP synthesis involves:

  • Methane Oxidation and Electron Transport:

    • Initial oxidation of methane to methanol by methane monooxygenase

    • Further oxidation steps generating reducing equivalents (NADH)

    • Electron transport through respiratory chain complexes

    • Establishment of proton gradient across the membrane

  • ATP Synthesis via ATP Synthase:

    • Protons flow through the F0 sector (containing atpB1)

    • Rotation of the central stalk

    • Conformational changes in F1 catalytic sites

    • ATP synthesis from ADP and Pi

  • Metabolic Integration:
    M. capsulatus primarily utilizes the ribulose monophosphate (RuMP) pathway for carbon assimilation . ATP generated by ATP synthase powers:

    • Biosynthetic reactions in the RuMP pathway

    • Cell maintenance and growth

    • Transport processes

    • Stress responses

Pathway ComponentFunctionRelation to ATP Synthase
Methane MonooxygenaseInitial methane oxidationConsumes reducing equivalents
Electron Transport ChainGenerates proton gradientCreates driving force for ATP synthase
ATP Synthase (with atpB1)ATP productionUtilizes proton gradient for energy conversion
RuMP PathwayCarbon assimilationRequires ATP for anabolic reactions

Understanding atpB1's specific role provides insights into how M. capsulatus optimizes energy conversion during growth on methane, which has implications for both fundamental bioenergetics and biotechnology applications such as single-cell protein production .

What techniques are most effective for studying the structure and assembly of ATP synthase complexes containing atpB1?

Investigating the structure and assembly of ATP synthase complexes containing atpB1 requires specialized techniques that can address the challenges of membrane protein complexes. The following methodological approaches are recommended:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Sample preparation: Purify intact ATP synthase complexes in suitable detergents or nanodiscs

    • Data collection: Use direct electron detectors with motion correction

    • Image processing: Apply 2D classification and 3D reconstruction

    • Advantages: Can resolve large complexes without crystallization; preserves native state

  • Native Mass Spectrometry:

    • Sample preparation: Purify complex in MS-compatible detergents

    • Instrumentation: High-resolution Q-TOF or Orbitrap systems

    • Analysis: Determine subunit stoichiometry and interaction partners

    • Advantages: Reveals complex composition and stability

  • Crosslinking Mass Spectrometry (XL-MS):

    • Methodology: Treat purified complexes with crosslinking reagents

    • Sample processing: Digest crosslinked samples and analyze by LC-MS/MS

    • Data analysis: Identify crosslinked peptides and map interaction sites

    • Advantages: Provides spatial constraints for modeling subunit arrangements

  • Fluorescence Resonance Energy Transfer (FRET):

    • Design: Generate fusion constructs with suitable fluorophores

    • Measurements: Analyze energy transfer efficiency

    • Analysis: Calculate distances between labeled components

    • Advantages: Can be performed in living cells; dynamic information

  • Blue Native PAGE and Complex Analysis:

    • Sample preparation: Solubilize membranes in mild detergents

    • Electrophoresis: Separate intact complexes

    • Detection: Western blotting with anti-atpB1 antibodies

    • Advantages: Simple technique to assess complex integrity and composition

A multi-technique approach combining these methods would provide complementary information about how atpB1 integrates into the ATP synthase complex and contributes to its structure and function.

How do environmental conditions affect the expression and activity of ATP synthase containing atpB1 in M. capsulatus?

M. capsulatus adapts to various environmental conditions, which influences the expression and activity of its ATP synthase. Understanding these adaptations requires systematic analysis of gene expression, protein levels, and enzyme activity under different growth conditions:

  • Oxygen Concentration Effects:
    M. capsulatus is an obligate aerobe , but oxygen concentration affects its metabolism:

    • High O2: Likely upregulation of ATP synthase to support increased metabolic demand

    • Microaerobic conditions: Possible adjustments in ATP synthase composition/activity

    • Methodology: Grow cultures in bioreactors with controlled dissolved oxygen; measure atpB1 expression by qRT-PCR and protein levels by Western blotting

  • Methane Concentration Effects:
    As the primary energy source, methane availability influences energy metabolism:

    • High methane: Potentially increased ATP synthase expression

    • Methane limitation: Possible regulatory adjustments to optimize energy conservation

    • Methodology: Chemostat cultures with varying methane input; assess ATP synthase activity in membrane vesicles

  • Temperature Adaptation:
    M. capsulatus can grow at various temperatures, affecting membrane properties:

    • Temperature shifts may alter membrane fluidity and ATP synthase activity

    • Structural adaptations in ATP synthase may occur at different temperatures

    • Methodology: Compare ATP synthesis rates in membranes isolated from cells grown at different temperatures (30-55°C)

  • pH Effects:
    External pH affects the proton gradient that drives ATP synthase:

    • pH changes may alter expression of ATP synthase subunits

    • Activity optimum may shift with environmental pH

    • Methodology: Measure ATP synthesis/hydrolysis at varying pH values; assess proton pumping in reconstituted systems

Environmental FactorExpected Effect on atpB1/ATP SynthaseExperimental ApproachKey Parameters to Measure
Oxygen ConcentrationExpression level changes; possible isoform preferenceControlled bioreactor cultivationGene expression (qPCR); protein levels (Western blot)
Methane AvailabilityActivity regulation; potential phosphorylation changesChemostat with varying methane inputATP synthesis rates; PTM analysis by MS
TemperatureStructural adaptations; activity optima shiftsGrowth at different temperaturesThermal stability; activation energy
pHProton-handling adjustments; expression changespH-controlled fermentationpH-dependent activity; proton/ATP ratios

Understanding these environmental responses provides insights into how M. capsulatus optimizes energy conservation under different conditions, which has implications for both fundamental research and biotechnological applications like single-cell protein production .

What are the optimal storage conditions for recombinant M. capsulatus atpB1 to maintain structural integrity and function?

Based on information about related ATP synthase subunits, the following storage protocols are recommended to maintain the structural integrity and function of recombinant M. capsulatus atpB1:

  • Short-term Storage (1-2 weeks):

    • Store at 4°C in suitable buffer containing:

      • 50 mM Tris-HCl or phosphate buffer, pH 7.5-8.0

      • 100-150 mM NaCl

      • 0.02-0.05% appropriate detergent (DDM, CHAPS, or similar)

      • 5-10% glycerol

    • Avoid repeated freeze-thaw cycles

  • Long-term Storage:

    • Aliquot protein to minimize freeze-thaw cycles

    • Use buffer containing 50% glycerol final concentration

    • Store at -20°C/-80°C

    • Consider flash-freezing in liquid nitrogen

    • Include antioxidants (e.g., 1 mM DTT) to prevent oxidation damage

  • Lyophilization Option:

    • Lyophilized powder form may be suitable for extended storage

    • Requires appropriate buffer components like trehalose (6%) for stabilization

    • Store lyophilized protein at -20°C/-80°C

  • Reconstitution Protocol:

    • Briefly centrifuge vial before opening to collect contents

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for aliquots

Storage MethodBuffer CompositionTemperatureExpected StabilityNotes
Short-term liquidTris/PBS-based buffer with detergent4°C1-2 weeksMonitor regularly for precipitation
Glycerol stockTris/PBS-based buffer, 50% glycerol-20°C/-80°CSeveral monthsAliquot to avoid freeze-thaw cycles
LyophilizedTris/PBS-based buffer, 6% trehalose-20°C/-80°C1+ yearCentrifuge before opening

Activity assays should be performed before and after storage to validate retention of function. For membrane proteins like atpB1, maintaining the integrity of the hydrophobic domains is particularly challenging, making the choice of detergent and cryoprotectant critical.

What analytical techniques are most suitable for assessing the purity and structural integrity of recombinant atpB1?

Multiple analytical techniques should be employed to comprehensively assess the purity and structural integrity of recombinant atpB1:

  • Purity Assessment:

    • SDS-PAGE: Standard method for purity determination (>90% purity is typically desired)

    • Size Exclusion Chromatography (SEC): Evaluates size homogeneity and aggregation state

    • Mass Spectrometry: Provides precise molecular weight and detects contaminants

  • Structural Integrity Analysis:

    • Circular Dichroism (CD): Assesses secondary structure content

    • Fourier Transform Infrared Spectroscopy (FTIR): Particularly useful for membrane proteins

    • Fluorescence Spectroscopy: Monitors tertiary structure through intrinsic tryptophan fluorescence

    • Thermal Shift Assays: Evaluates protein stability and proper folding

  • Functional Validation:

    • ATPase Activity Assays: Measures ATP hydrolysis rates when reconstituted with partner subunits

    • Proton Translocation Assays: Assesses function in proteoliposomes using pH-sensitive dyes

    • Binding Assays: Evaluates interaction with other ATP synthase subunits

  • Advanced Structural Characterization:

    • Limited Proteolysis: Probes for properly folded domains

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps solvent-accessible regions

    • Native MS: Evaluates oligomeric state and complex formation

TechniqueInformation ProvidedSample RequirementsAdvantages/Limitations
SDS-PAGEBasic purity assessment1-10 μg proteinSimple, standard method but limited resolution
SEC-MALSMolecular weight, aggregation, purity50-100 μg proteinProvides solution behavior information
CD SpectroscopySecondary structure content0.1-0.5 mg/ml, detergent-compatibleRapid assessment but interference from some buffers
Thermal ShiftStability, proper folding5-50 μg proteinHigh-throughput compatible
Native MSOligomeric state, complex integrity10-50 μg proteinRequires specialized equipment
HDX-MSDynamic structural information50-100 μg proteinDetailed structural insights but complex analysis

A combination of these techniques provides a comprehensive assessment of protein quality, enabling researchers to proceed confidently with functional and structural studies of recombinant atpB1.

What are the best approaches for developing specific antibodies against M. capsulatus atpB1 for research applications?

Developing specific antibodies against membrane proteins like atpB1 presents unique challenges. The following methodological approach is recommended:

  • Antigen Design Strategies:

    • Synthetic Peptide Approach:

      • Identify 15-20 amino acid sequences unique to atpB1

      • Select regions with high predicted antigenicity

      • Avoid transmembrane segments

      • Conjugate to carrier protein (KLH or BSA)

    • Recombinant Protein Fragments:

      • Express soluble domains or epitope-enriched fragments

      • Use His-tag for purification

      • Consider fusion partners to enhance solubility

    • Full-length Protein:

      • Purify detergent-solubilized full-length atpB1

      • Reconstitute in liposomes or nanodiscs to preserve native structure

  • Immunization Protocols:

    • Animals: Rabbits for polyclonal; mice or rats for monoclonal development

    • Adjuvants: Complete Freund's for initial immunization; incomplete for boosters

    • Schedule: Initial immunization followed by 3-4 boosts at 2-3 week intervals

    • Monitoring: ELISA testing of serum titers

  • Antibody Production Methods:

    • Polyclonal Antibodies:

      • Collect serum after sufficient titer is achieved

      • Purify using antigen-specific affinity chromatography

    • Monoclonal Antibodies:

      • Harvest B cells from immunized mice

      • Perform hybridoma fusion with myeloma cells

      • Screen, select, and expand positive clones

  • Validation Techniques:

    • Western blotting against recombinant protein and native extracts

    • Immunoprecipitation to confirm specificity

    • Immunofluorescence in fixed cells

    • Negative controls with pre-immune serum

Antigen StrategyAdvantagesLimitationsApplications
Synthetic PeptidesSpecific sequence targeting; cost-effectiveMay miss conformational epitopesWestern blotting; simple immunoassays
Recombinant FragmentsBetter representation of protein domainsMore complex productionWestern blotting; immunoprecipitation
Full-length ProteinNative-like epitopes; comprehensive coverageTechnically challenging; may have non-specific regionsAll applications including structural studies

For optimal results, consider developing antibodies against multiple regions of atpB1 and thoroughly validating specificity against both recombinant protein and native M. capsulatus extracts. Cross-reactivity with atpB2 should be carefully assessed due to potential sequence similarities between these related subunits.

How can isotope labeling approaches be used to study the structural dynamics of atpB1 within the ATP synthase complex?

Isotope labeling provides powerful tools for investigating the structural dynamics of membrane proteins like atpB1. The following methodological approaches can be applied:

  • NMR-based Methods:

    • Selective 15N/13C Labeling:

      • Express atpB1 in E. coli grown in minimal media with 15N-ammonium sulfate and 13C-glucose

      • Selectively label specific amino acids to reduce spectral complexity

      • Analyze by solution or solid-state NMR

    • TROSY-NMR for Large Complexes:

      • Deuterate protein to improve relaxation properties

      • Apply TROSY (Transverse Relaxation Optimized Spectroscopy) techniques

      • Monitor chemical shift perturbations upon complex formation

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Expose purified atpB1 or ATP synthase complexes to D2O buffer

    • Quench exchange at various time points

    • Digest with pepsin and analyze by LC-MS/MS

    • Map exchange rates to identify protected regions and interaction interfaces

  • Site-specific Labeling for FRET/EPR Studies:

    • Introduce unique cysteines at strategic positions in atpB1

    • Label with fluorophores (for FRET) or spin labels (for EPR)

    • Measure distances and conformational changes during ATP synthase function

    • Combine with functional assays to correlate structure with activity

  • Crosslinking Combined with Mass Spectrometry:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest and identify crosslinked peptides by MS/MS

    • Generate distance constraints for structural modeling

    • Use cleavable crosslinkers for reversible capture

TechniqueInformation ObtainedTechnical ChallengesSolution Strategies
15N/13C NMRAtomic-level dynamics; local structureSignal overlap; size limitationsSelective labeling; deuteration; TROSY techniques
HDX-MSSolvent accessibility; conformational changesBack-exchange; membrane protein analysisOptimized quenching; specialized digestion conditions
Site-specific FRETDistance measurements; conformational changesBackground labeling; protein functionalityUnique cysteine introduction; functional validation
Crosslinking MSInteraction interfaces; proximity mappingCrosslinker accessibility; data analysisVarying crosslinker lengths; specialized software

These approaches can reveal:

  • Conformational changes in atpB1 during the catalytic cycle

  • Interaction interfaces with other ATP synthase subunits

  • Dynamics of proton translocation through the membrane domain

  • Structural adaptations under different physiological conditions

Understanding these dynamic aspects of atpB1 function provides mechanistic insights into ATP synthase operation in M. capsulatus, which may have implications for understanding energy metabolism in methanotrophic bacteria and potential biotechnological applications.

What reconstitution systems are most effective for studying the function of atpB1 in vitro?

Functional reconstitution of membrane proteins like atpB1 is essential for detailed mechanistic studies. The following methodological approaches are recommended for in vitro functional analysis:

  • Proteoliposome Reconstitution:

    • Composition: Synthetic phospholipids (POPC/POPE/POPG) or E. coli lipid extract

    • Method: Detergent removal via dialysis, Bio-Beads, or gel filtration

    • Protein:Lipid Ratio: Optimize ratio (typically 1:50 to 1:200 w/w)

    • Functional Assays: Proton pumping using pH-sensitive dyes (ACMA, pyranine)

    • Advantages: Mimics native membrane environment; suitable for transport studies

  • Nanodiscs:

    • Components: Membrane scaffold proteins (MSP1D1) and selected lipids

    • Assembly: Controlled formation of disc-shaped bilayers containing atpB1

    • Size Control: MSP variant selection determines nanodisc diameter

    • Applications: Structural studies; defined stoichiometry; enhanced stability

    • Advantages: Soluble particles; no detergent; size homogeneity

  • Amphipols:

    • Approach: Replace detergents with amphipathic polymers

    • Procedure: Incubate detergent-solubilized atpB1 with amphipols; remove detergent

    • Types: A8-35 (most common); SAPols (sulfonated); fluorescent variants

    • Applications: Structural studies; enhanced stability

    • Advantages: Detergent-free; stabilizes native conformation

  • Co-reconstitution with Partner Subunits:

    • Strategy: Combine purified atpB1 with other ATP synthase subunits

    • Assembly: Stepwise addition or simultaneous reconstitution

    • Validation: ATP synthesis/hydrolysis assays

    • Applications: Mechanistic studies of coupled proton transport and ATP synthesis

    • Advantages: Functional context; mechanistic insights

Reconstitution SystemOptimal ApplicationsTechnical ConsiderationsFunctional Assays
ProteoliposomesTransport studies; ATP synthesisProtein orientation; leakinessACMA fluorescence quenching; luciferin/luciferase ATP assay
NanodiscsStructural studies; controlled stoichiometryMSP:protein:lipid ratiosATPase activity; binding studies
AmphipolsLong-term stability; structural analysisComplete detergent removalLimited for functional studies
Polymer-based systems (SMALPs)Native lipid environment preservationSize heterogeneityVarious activity assays

For atpB1 specifically:

  • Start with proteoliposome reconstitution to establish basic functionality

  • Progress to nanodiscs for detailed structural and interaction studies

  • Consider co-reconstitution with partnering subunits to understand subunit cooperation

  • Validate system by demonstrating proton translocation coupled to ATP synthesis

These reconstitution systems provide complementary approaches to understand the function of atpB1 in controlled environments, allowing detailed mechanistic investigations into how this subunit contributes to ATP synthesis in M. capsulatus.

How can computational modeling be used to predict the structure and function of atpB1 in M. capsulatus?

Computational modeling provides valuable insights into membrane proteins like atpB1 when experimental structural data is limited. The following methodological approaches are recommended:

  • Homology Modeling:

    • Template Selection: Identify structurally resolved ATP synthase subunit a from related organisms

    • Sequence Alignment: Perform multiple sequence alignment to identify conserved regions

    • Model Building: Generate models using software like MODELLER, SWISS-MODEL, or Rosetta

    • Refinement: Energy minimization and loop refinement

    • Validation: PROCHECK, ERRAT, ProSA for model quality assessment

  • Ab Initio and Threading Methods:

    • Approach: Use AlphaFold2, RosettaMP, or I-TASSER for template-free modeling

    • Membrane Protein Specialization: Apply membrane-specific scoring functions

    • Domain Assembly: Integrate individual domain predictions

    • Confidence Assessment: Analyze prediction confidence scores

  • Molecular Dynamics Simulations:

    • System Preparation: Embed modeled atpB1 in lipid bilayer with appropriate composition

    • Force Fields: CHARMM36, AMBER, or MARTINI (for coarse-grained simulations)

    • Simulation Types:

      • Equilibrium MD (100+ ns) to assess stability

      • Steered MD to study proton pathways

      • Coarse-grained simulations for longer timescales

    • Analysis: RMSD, RMSF, hydrogen bonding networks, water/ion pathways

  • Functional Site Prediction:

    • Conservation Analysis: ConSurf to identify evolutionarily conserved residues

    • Binding Site Prediction: CASTp, FTSite for potential interaction surfaces

    • Electrostatic Analysis: APBS to map proton pathways

    • Correlated Motion Analysis: Normal mode analysis to identify functional movements

Computational MethodPrimary ApplicationAdvantagesLimitations
Homology ModelingBasic structural predictionFast; reliable when templates availableDepends on template quality; limited for novel folds
AlphaFold2/RosettaMPTemplate-free predictionCan predict novel structures; good for transmembrane regionsComputationally intensive; challenging for large complexes
MD SimulationsDynamic behavior; proton pathwaysProvides dynamic information; includes environmentTime scale limitations; force field accuracy
Protein-Protein DockingInterface prediction with other subunitsPredicts complex assemblyMembrane environment challenges; flexibility issues

These computational approaches can address questions such as:

  • How do specific residues in atpB1 contribute to proton translocation?

  • What conformational changes occur during the catalytic cycle?

  • How does atpB1 interact with other ATP synthase subunits?

  • What are the effects of pH or mutations on protein structure and function?

Integration of computational predictions with experimental validation (e.g., site-directed mutagenesis followed by functional assays) creates a powerful approach for understanding the structure-function relationship of atpB1 in M. capsulatus ATP synthase.

How does atpB1 from M. capsulatus compare to ATP synthase subunits in other methanotrophic bacteria?

Understanding the evolutionary relationships and functional differences of atpB1 across methanotrophic bacteria provides valuable insights into adaptation and specialization. The following comparative analysis approaches are recommended:

  • Sequence-Based Comparisons:

    • Perform multiple sequence alignment of atpB1 homologs from diverse methanotrophs

    • Calculate sequence identity/similarity percentages

    • Identify conserved motifs and variable regions

    • Apply conservation analysis (ConSurf) to map evolutionary constraints

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using Maximum Likelihood or Bayesian methods

    • Analyze evolutionary rates across different methanotroph lineages

    • Identify potential horizontal gene transfer events

    • Correlate evolutionary patterns with ecological niches

  • Structural Comparisons:

    • Generate homology models of atpB1 from different methanotrophs

    • Superimpose models to identify structural variations

    • Analyze differences in predicted proton channels

    • Evaluate electrostatic surface properties

  • Functional Domain Analysis:

    • Compare transmembrane topology predictions

    • Identify differences in key functional residues

    • Analyze variations in interaction surfaces with other subunits

    • Evaluate potential differences in proton translocation mechanisms

Methanotroph GroupExpected atpB1 FeaturesEcological SignificanceMethodological Considerations
Type I (Gammaproteobacteria like M. capsulatus)Original reference group Wide temperature range adaptation; industrial relevance Well-characterized genome
Type II (Alphaproteobacteria)Potentially different conservation patternsDifferent carbon assimilation pathwayConsider pathway integration differences
Verrucomicrobia methanotrophsHighly divergent sequencesAcidophilic adaptationSpecial attention to pH adaptation features
Anaerobic methanotrophsMay lack conventional ATP synthaseDifferent energy conservation mechanismsConsider alternative complexes

This comparative approach reveals:

  • Core conserved features essential for ATP synthase function across all methanotrophs

  • Lineage-specific adaptations related to environmental conditions

  • Potential functional innovations in specific methanotroph groups

  • Correlation between ATP synthase variations and metabolic strategies

Understanding these evolutionary patterns provides context for interpreting experimental results and may suggest targeted mutations or chimeric constructs for functional studies of atpB1.

What can be learned from comparing atpB1 and atpB2 paralogs in M. capsulatus?

M. capsulatus contains both atpB1 and atpB2 paralogs, providing an opportunity to understand functional divergence and specialization. The following methodological approaches can elucidate the relationship between these paralogs:

  • Sequence and Structure Comparison:

    • Perform pairwise alignment between atpB1 and atpB2

    • Identify conserved vs. divergent regions

    • Generate structural models of both paralogs

    • Compare predicted transmembrane topologies

  • Expression Pattern Analysis:

    • Analyze transcriptomic data under different growth conditions

    • Perform qRT-PCR to quantify relative expression levels

    • Use Western blotting with paralog-specific antibodies

    • Determine if expression is constitutive or condition-dependent

  • Functional Complementation Studies:

    • Generate knockout mutants (ΔatpB1, ΔatpB2, and double knockout if viable)

    • Perform growth studies under various conditions

    • Measure ATP synthesis rates in membrane vesicles

    • Attempt cross-complementation between paralogs

  • Biochemical Characterization:

    • Express and purify both recombinant proteins

    • Compare stability, pH optima, and temperature sensitivity

    • Analyze integration efficiency into ATP synthase complexes

    • Measure proton translocation efficiency

FeatureAnalysis ApproachExpected DifferencesFunctional Implications
Sequence ConservationMultiple sequence alignmentVariable and conserved regionsCore function vs. specialized adaptations
Expression PatternsRNA-Seq; qRT-PCRCondition-dependent expressionEnvironmental adaptation strategies
Protein-Protein InteractionsCo-IP; crosslinking; BN-PAGEDifferent interaction partnersAssembly variations; regulatory differences
Proton Channel PropertiesElectrophysiology; pH-sensitive dyesEfficiency; specificity; regulationEnergy coupling differences

Based on studies of gene duplications in other systems, several hypotheses can be tested:

  • Subfunctionalization: atpB1 and atpB2 may have divided ancestral functions

  • Neofunctionalization: One paralog may have acquired novel functions

  • Expression Divergence: Paralogs may be expressed under different conditions

  • Assembly Variation: Paralogs may participate in different ATP synthase complexes

Understanding the relationship between these paralogs provides insights into how ATP synthase function has evolved in M. capsulatus and may reveal specialized adaptations to its methanotrophic lifestyle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.