Recombinant Methylococcus capsulatus ATP synthase subunit a 2 (atpB2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare accordingly.
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery times may vary based on purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please contact us in advance, as additional fees will apply.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
atpB2; MCA2699; ATP synthase subunit a 2; ATP synthase F0 sector subunit a 2; F-ATPase subunit 6 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
atpB2
Target Protein Sequence
MEQIDFFARVLGHLGPVTVSDSLLTSVLVAGLLSAASAVLTRRRTALPDRVQVVLEGIVS
ACENAVRDVIPTAYREVTPFIMSLWLFLATANLISLVPGFDSPTRDLSVTSALAVLVFFS
VHWFGIRQQGLSAYLKHYLTPNPVLLPFHLIGEITRTLALAIRLFGNMMSMELIGLLLLI
IGGLFVPVPVLLLHVVEGLVQAYIFGILALVYIAGGIQSGPQQENHSP
Uniprot No.
Target Background
Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
KEGG: mca:MCA2699
STRING: 243233.MCA2699
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
