Recombinant Methylococcus capsulatus Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

MsbA is an ATP-binding cassette (ABC) transporter essential for flipping lipid A (a component of lipopolysaccharide, LPS) across the inner membrane of Gram-negative bacteria. It operates via an alternating-access mechanism, switching between inward- and outward-facing conformations to translocate substrates .

Key Functions of MsbA:

FunctionMechanismOrganism Examples
Lipid A flippingATP-driven transport to periplasmic leafletSalmonella typhimurium, Pseudomonas fluorescens
Multidrug resistanceEfflux of amphipathic drugsEscherichia coli, Burkholderia pseudomallei
Membrane integrityMaintenance via lipid asymmetryGram-negative bacteria

Lipid A Transport

MsbA employs a trap-and-flip mechanism:

  1. Inward-facing conformation: TMDs open to bind lipid A .

  2. ATP binding: NBDs close, triggering TMD closure and lipid A translocation .

  3. ATP hydrolysis: NBDs separate, releasing lipid A to the periplasm .

Thermodynamic Studies (e.g., Salmonella MsbA):

MutantΔG (kJ/mol)ΔH (kJ/mol)-TΔS (kJ/mol)
Wild-type-30.2 ± 0.2 to -32.5 ± 0.243 ± 2–53 ± 1-75 ± 2 to -86 ± 1
R78AReduced bindingEntropic gain dominates

Multidrug Resistance

MsbA interacts with amphipathic drugs (e.g., MIANS-labeled proteins), altering conformation and quenching fluorescence . Mutations in residues like R78A or K299A disrupt substrate binding via enthalpy-entropy compensation .

Limitations and Future Directions

  • Organism-Specific Data Gap: No studies directly address M. capsulatus MsbA.

  • Structural Variability: Conformations differ between lipid-bound and nucleotide-bound states .

  • Evolutionary Adaptation: M. capsulatus’ copper metabolism genes (e.g., CopA homologs) suggest potential regulatory links to MsbA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
msbA; MCA0964; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
msbA
Target Protein Sequence
MKHSASESKPLSSGLAIYRRLLRYGFPYWRSFCVAVVAMIAYAAITPFFAKLIQPLIDGS FIDNDPTVLRQVSLMLIGLSVLRGIAGFLSEYCSGSVGRRVIADLRRDIFDQLLNLPCSF YDNASGGQLLSKLLYNTEQVSASLQQGIITCIREGFTVIGLMALMVYQNPVLSLVFLVLG PVLGLSVRFVSKRFRRLSMRIQESMGKVSHVTQEVIDAQRIVKVFNGKDYEAAKFATEND RNQKRQMKLIATDALGGGVIHLISVAGVAGILYVVSLDSVRQTITPGSLMAFIAAMAMML SPIRRLSQVVSVMQRGIAAGDSIFAMLDLPRERDRGRISLKRARGSIEYRHVSLVYDDRH GAAVDDVSLVIPAGKTVALVGQSGSGKTSLVRLLPRLYEATAGEILIDGHDIRELTLESL RRQIAYVGQEVTLFNDTVASNIAYGCLDRVGLDAVREAARAANALDFIETLPQGFDTLVG QQGIVLSGGQRQRIAIARALLKNAPILILDEATSALDAESERYVQQALEVLMQNRTTLVI AHRLSTIQNADQICVMRGGRIIECGTHAQLMAARGGYADLYAMQFGYSSVPEAVAVHAVR R
Uniprot No.

Target Background

Function

Function: This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.

Database Links

KEGG: mca:MCA0964

STRING: 243233.MCA0964

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylococcus capsulatus and why is it significant for research?

Methylococcus capsulatus (Bath) is a methane-oxidizing gamma-proteobacterium first isolated by Foster and Davis in 1966. As an obligate methanotroph, it has garnered significant research interest for multiple reasons. The organism plays a crucial role in the global carbon cycle as a methane consumer and has demonstrated notable effects on both human and animal health. Studies have shown that M. capsulatus Bath can interact with human dendritic cells, influencing DC maturation, cytokine production, and subsequent T cell activation, proliferation and differentiation . This bacterium has also demonstrated anti-inflammatory properties in murine models of colitis .

From a metabolic perspective, M. capsulatus possesses a unique C1 metabolism that enables it to utilize methane as its primary carbon source. It can express two distinct types of methane monooxygenases: a soluble form (sMMO) and a particulate, membrane-bound form (pMMO), with expression strongly influenced by extracellular copper concentrations . The organism contains a complete Calvin-Benson-Bassham cycle and a partial Serine pathway for formaldehyde assimilation .

Beyond fundamental research, M. capsulatus has been utilized commercially as the primary microorganism for Single Cell Protein (SCP) production as animal feed since the 1970s, with renewed interest due to increased availability of natural gas as an economical feedstock .

What is the structure and function of the Lipid A export ATP-binding/permease protein MsbA in M. capsulatus?

The Lipid A export ATP-binding/permease protein MsbA (msbA) in M. capsulatus is a membrane transport protein belonging to the ATP-binding cassette (ABC) transporter family. Based on the sequence information, it functions as an ATP-dependent transporter primarily involved in the export of Lipid A, a key component of lipopolysaccharides found in the outer membrane of Gram-negative bacteria .

The protein consists of 601 amino acids and contains characteristic domains of ABC transporters:

  • Nucleotide-binding domains that bind and hydrolyze ATP

  • Transmembrane domains that form a channel for substrate translocation

  • Specific substrate-binding regions that recognize Lipid A and related molecules

The full amino acid sequence reveals conserved motifs typical of ABC transporters, including Walker A and B motifs for ATP binding and the signature ABC transporter sequence . This structure enables MsbA to couple ATP hydrolysis with the transport of amphipathic molecules across the bacterial membrane, which is essential for maintaining membrane integrity and cellular physiology.

How does recombinant MsbA protein from M. capsulatus differ from homologous proteins in other bacteria?

  • Sequence variations: The specific amino acid sequence provided in the search results would likely show both conserved regions (particularly in the ATP-binding cassettes) and variable regions that may reflect adaptation to M. capsulatus's unique methanotrophic lifestyle.

  • Substrate specificity: While the core function of lipid A transport is conserved, the specific lipid A structure in M. capsulatus may differ from other bacteria, potentially requiring adaptations in the substrate-binding regions of MsbA.

  • Environmental adaptations: As a methanotroph that exists in unique ecological niches, the M. capsulatus MsbA may have evolved features that optimize function under the organism's preferred growth conditions, including temperature optima that align with its environmental preferences.

  • Regulatory mechanisms: The expression and regulation of MsbA may be integrated with methane metabolism pathways unique to methanotrophs.

Comparative sequence analysis using bioinformatics tools would be the first step in identifying these differences, followed by functional characterization through biochemical assays.

What expression systems and purification strategies are optimal for producing functional recombinant M. capsulatus MsbA protein?

For successful production of functional M. capsulatus MsbA protein, researchers should consider:

Expression Systems:

  • E. coli-based expression systems:

    • C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Tunable promoters (e.g., PBAD, Ptet) to control expression levels

    • Fusion tags to enhance solubility and facilitate purification

  • Alternative expression hosts:

    • Pichia pastoris for higher yields of functional membrane proteins

    • Cell-free expression systems to avoid toxicity issues

Purification Strategy:

StepMethodDetails
Cell LysisPhysical disruptionFrench press or sonication in buffer containing protease inhibitors
Membrane IsolationDifferential centrifugation10,000×g to remove debris, 100,000×g to collect membranes
SolubilizationDetergent extractionScreening of detergents (DDM, LMNG, DMNG) at 1-2% concentrations
Affinity PurificationIMAC or other affinity chromatographyBased on fusion tag (His, GST, MBP)
Size ExclusionGel filtrationTo remove aggregates and obtain homogeneous protein
Quality ControlSDS-PAGE, Western blot, Mass spectrometryTo confirm purity and identity

The storage buffer mentioned in the product description (Tris-based buffer with 50% glycerol) provides a starting point for stabilization of the purified protein.

What are the basic functional assays to verify the activity of purified recombinant M. capsulatus MsbA?

To confirm that purified recombinant M. capsulatus MsbA protein is functionally active, researchers should employ multiple complementary assays:

1. ATP Hydrolysis Assays:

  • Malachite green phosphate detection assay to measure released phosphate

  • Coupled enzyme assay with pyruvate kinase and lactate dehydrogenase

  • Luciferase-based ATP consumption assay

2. Substrate Binding Assays:

  • Fluorescence-based binding assays using labeled lipid A analogs

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

3. Transport Assays:

  • Reconstitution into proteoliposomes for direct transport measurements

  • Fluorescence-based transport assays using fluorescent lipid analogs

  • Resistance complementation assays in MsbA-deficient bacteria

4. Conformational Change Assays:

  • Limited proteolysis to detect ATP-dependent conformational changes

  • Intrinsic tryptophan fluorescence changes upon substrate binding

  • Hydrogen-deuterium exchange mass spectrometry

Each assay provides different information about protein functionality, and combining multiple approaches provides the most comprehensive validation of active recombinant protein.

How might the function of MsbA contribute to M. capsulatus's unique metabolic capabilities?

The role of MsbA in supporting M. capsulatus's specialized metabolism presents an interesting research question with several dimensions:

  • Membrane Architecture Support: M. capsulatus utilizes membrane-bound particulate methane monooxygenase (pMMO) for methane oxidation . MsbA's role in lipid transport is critical for maintaining the specific membrane composition that supports pMMO activity. The three proposed modes of electron transfer to pMMO (redox-arm, direct coupling, and uphill electron transfer) all depend on proper membrane organization.

  • Adaptation to Metabolic Stress: Methane oxidation generates reactive intermediates that can cause membrane damage. MsbA may play a role in membrane repair and lipid turnover, contributing to stress resistance during active methanotrophy.

  • Integration with Energy Metabolism: The genome-scale metabolic model for M. capsulatus indicates complex bioenergetic pathways . MsbA's ATP consumption must be balanced within this network, particularly considering the high energy demands of methane oxidation.

  • Signal Transduction: The copper-dependent switch between sMMO and pMMO expression likely involves membrane-associated signaling. MsbA-dependent lipid distribution could influence these signaling pathways.

Research approaches to investigate these connections might include:

  • Comparative proteomics and lipidomics under different growth conditions

  • Conditional MsbA expression systems to observe metabolic impacts

  • Integration of MsbA function into genome-scale metabolic models

What is the relationship between MsbA function and the immunomodulatory properties of M. capsulatus?

The search results indicate that M. capsulatus Bath demonstrates specific interactions with dendritic cells (DCs) and can prevent experimentally induced colitis in a murine model of inflammatory bowel disease (IBD) . MsbA's role in lipid A transport suggests potential connections to these immunomodulatory properties:

  • Lipopolysaccharide (LPS) Structure: MsbA transports lipid A, the anchor component of LPS. The specific structure of M. capsulatus LPS likely contributes to its intermediate capacity to induce DC maturation compared to E. coli and L. rhamnosus GG . This differential immune stimulation may explain its beneficial effects in colitis models.

  • Outer Membrane Vesicle (OMV) Formation: MsbA activity affects outer membrane composition, potentially influencing OMV production. These vesicles can carry immunomodulatory molecules that interact with host immune cells.

  • Adherence to Dendritic Cells: The search results describe specific adherence of M. capsulatus to dendritic cells but not to monocytes . This selective binding may depend on outer membrane components whose distribution is influenced by MsbA activity.

Experimental approaches to investigate these relationships could include:

  • Comparing wild-type and MsbA-modified M. capsulatus strains in DC maturation assays

  • Analysis of lipid A structure and its correlation with immunomodulatory effects

  • In vivo studies using modified strains in animal models of inflammatory disease

How do environmental factors influence the expression and activity of MsbA in M. capsulatus?

Understanding the regulation of MsbA expression and activity in response to environmental conditions is crucial for both fundamental research and biotechnological applications:

Environmental FactorPotential Impact on MsbAResearch Method
Copper ConcentrationMay coordinate with the copper-dependent switch between sMMO and pMMO qRT-PCR of msbA expression at varying copper concentrations
Oxygen TensionCould affect membrane composition and MsbA substrate availabilityComparative proteomics under different O₂ conditions
Methane AvailabilityMay influence lipid metabolism and consequently MsbA activityMetabolic flux analysis with labeled substrates
pH VariationCould alter membrane properties and MsbA conformational stabilityActivity assays at different pH values
TemperatureMay affect lipid fluidity and MsbA transport kineticsThermal stability assays and temperature-dependent activity measurements

M. capsulatus has evolved to thrive in specific ecological niches with fluctuating methane and oxygen levels. The regulation of membrane transport proteins like MsbA likely plays a crucial role in this adaptation, potentially through mechanisms that integrate membrane homeostasis with central metabolism.

What advanced structural biology techniques can be applied to study M. capsulatus MsbA?

Researchers investigating the structural details of M. capsulatus MsbA can employ several cutting-edge approaches:

X-ray Crystallography:

  • Lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

  • Use of antibody fragments or nanobodies to stabilize specific conformations

  • Collection of diffraction data at microfocus beamlines for microcrystals

Cryo-Electron Microscopy:

  • Single-particle analysis with detergent-solubilized or nanodisc-reconstituted MsbA

  • Tomography of membrane-embedded MsbA to visualize native context

  • Time-resolved cryo-EM to capture transport cycle intermediates

Spectroscopic Methods:

  • Double electron-electron resonance (DEER) spectroscopy with site-directed spin labeling

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

  • Solid-state NMR of reconstituted MsbA in native-like lipid environments

Computational Approaches:

  • Molecular dynamics simulations in explicit membrane environments

  • Homology modeling based on existing ABC transporter structures

  • Quantum mechanics/molecular mechanics (QM/MM) calculations of the ATP hydrolysis mechanism

These techniques would provide complementary information about different aspects of MsbA structure and dynamics, helping to understand how its function is optimized for M. capsulatus's unique physiology.

How can researchers effectively study the interaction between MsbA and the methane oxidation machinery in M. capsulatus?

Investigating potential functional connections between MsbA and methane oxidation systems requires specialized approaches:

1. Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation using antibodies against MsbA and methane oxidation components

  • Proximity labeling techniques (BioID, APEX) with MsbA as the bait protein

  • Membrane protein crosslinking followed by mass spectrometry

  • Split reporter assays (DHFR, luciferase) to test specific interaction pairs

2. Membrane Organization Studies:

  • Super-resolution microscopy to visualize spatial relationships between MsbA and pMMO

  • Fluorescence correlation spectroscopy to analyze diffusion dynamics

  • Atomic force microscopy of native membranes to map protein distributions

  • Density gradient centrifugation to isolate membrane microdomains

3. Functional Coupling Analysis:

  • Generation of conditional MsbA mutants and measurement of methane oxidation rates

  • Lipidomic analysis of pMMO-associated lipids dependent on MsbA function

  • In vitro reconstitution of coupled systems in proteoliposomes

  • Bioenergetic analysis using membrane potential-sensitive dyes

4. Systems Biology Approaches:

  • Integration of MsbA within the existing genome-scale metabolic model

  • Multi-omics analysis correlating MsbA expression with methanotrophic activity

  • Flux balance analysis to predict the impact of altered MsbA function

These methodologies would help establish whether MsbA function is directly linked to methane oxidation or simply represents a parallel process necessary for general membrane homeostasis.

What bioinformatic approaches can be used to analyze MsbA in the context of M. capsulatus evolution and adaptation?

Computational analyses can provide valuable insights into the evolutionary history and functional adaptations of M. capsulatus MsbA:

1. Phylogenetic Analysis:

  • Construction of phylogenetic trees using MsbA sequences from diverse bacteria

  • Analysis of selection pressures using dN/dS ratios across different domains

  • Ancestral sequence reconstruction to identify key evolutionary transitions

  • Comparison with 16S rRNA phylogeny to identify potential horizontal gene transfer events

2. Structural Prediction and Analysis:

  • Homology modeling based on crystallized ABC transporters

  • Conservation mapping onto predicted structures to identify functional hotspots

  • Molecular dynamics simulations in different membrane compositions

  • Virtual screening for potential natural substrates or inhibitors

3. Genomic Context Analysis:

  • Examination of the msbA operon structure and potential co-regulated genes

  • Comparative genomics across methanotrophs to identify conserved patterns

  • Analysis of regulatory elements in the msbA promoter region

  • Detection of potential gene duplication events or paralogs

4. Systems-Level Integration:

These computational approaches complement experimental methods and can generate hypotheses about how MsbA has evolved to support M. capsulatus's specialized lifestyle.

What are the current technical limitations in studying M. capsulatus MsbA and how might they be overcome?

Researchers face several significant challenges when investigating M. capsulatus MsbA:

1. Membrane Protein Expression and Purification:

  • Challenge: Low expression yields and potential toxicity to host cells

  • Solution: Development of specialized expression systems with tunable promoters and fusion partners specifically optimized for M. capsulatus membrane proteins

2. Functional Reconstitution:

  • Challenge: Maintaining native lipid environment for proper activity

  • Solution: Extraction of native M. capsulatus lipids for reconstitution studies or synthesis of lipid mixtures that mimic the unique composition of methanotroph membranes

3. Genetic Manipulation:

  • Challenge: Limited genetic tools for M. capsulatus compared to model organisms

  • Solution: Adaptation of CRISPR-Cas9 and other genome editing tools specifically for methanotrophs; development of inducible expression systems

4. Structural Determination:

  • Challenge: Difficulty in obtaining high-resolution structures of membrane proteins

  • Solution: Application of lipidic cubic phase crystallization methods specifically optimized for ABC transporters; use of cryo-EM for structure determination without crystallization

5. Physiological Relevance:

  • Challenge: Connecting in vitro biochemical data to in vivo function

  • Solution: Development of fluorescent lipid A analogs for tracking transport in living cells; generation of conditional mutants for in vivo studies

Overcoming these challenges will require interdisciplinary approaches combining expertise in membrane biochemistry, methanotroph physiology, and advanced structural biology techniques.

How might our understanding of M. capsulatus MsbA contribute to biotechnological and biomedical applications?

Knowledge about M. capsulatus MsbA has several potential applications:

1. Biocatalysis and Industrial Biotechnology:

  • Engineering M. capsulatus with modified MsbA for enhanced membrane stability during industrial fermentation

  • Development of whole-cell biocatalysts with optimized membrane transport properties

  • Incorporation of lessons from M. capsulatus MsbA into other industrial strains to improve stress tolerance

2. Biomedical Applications:

  • Development of novel immunomodulatory agents based on understanding how M. capsulatus interacts with dendritic cells

  • Design of targeted probiotics for inflammatory bowel disease building on M. capsulatus's demonstrated protective effects in colitis models

  • Exploration of M. capsulatus components as adjuvants for vaccines based on their intermediate activation of dendritic cells

3. Antimicrobial Development:

  • Identification of unique features of M. capsulatus MsbA that differ from pathogenic bacteria

  • Design of selective inhibitors targeting pathogen MsbA while sparing beneficial bacteria

  • Structure-based drug design using insights from comparative analysis of MsbA proteins

4. Environmental Applications:

  • Engineering optimized methanotrophs for methane mitigation in environmental settings

  • Development of biosensors incorporating MsbA-dependent reporting systems

  • Enhanced production of single-cell protein from methane for sustainable animal feed

These applications represent the translational potential of fundamental research on M. capsulatus MsbA, connecting basic membrane biology to solutions for health, environmental, and industrial challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.