Recombinant Methylococcus capsulatus Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Overview of Na⁺-Translocating NADH-Quinone Reductase (Na⁺-NQR)

Na⁺-NQR is a respiratory enzyme complex that couples electron transfer from NADH to quinone with the translocation of sodium ions across the membrane. This enzyme is critical for generating an electrochemical sodium gradient, which drives ATP synthesis and other energy-dependent processes in prokaryotes . While extensively studied in Vibrio cholerae, Na⁺-NQR is also present in select methanotrophs like Methylococcus capsulatus, a methane-oxidizing gammaproteobacterium .

Subunit E (NqrE) in Na⁺-NQR

Subunit E (encoded by nqrE) is a transmembrane component of Na⁺-NQR. In V. cholerae, NqrE forms part of a structural and functional unit with NqrD, housing redox-active cofactors (e.g., Fe centers) critical for electron transfer . Structural studies reveal that NqrD-NqrE interactions stabilize the enzyme’s membrane-spanning architecture and facilitate sodium translocation .

Key Features of NqrE:

  • Topology: Predicted to contain multiple transmembrane helices.

  • Coordination: Partners with NqrD to anchor redox centers.

  • Functional Role: Likely involved in electron transfer between FMN cofactors and quinone .

Methylococcus capsulatus Na⁺-NQR and Subunit E

M. capsulatus possesses a diverse respiratory chain, including hydrogenases, cytochrome complexes, and methane oxidation enzymes . While genomic analyses confirm the presence of nqrE in M. capsulatus , direct characterization of recombinant NqrE remains limited. Comparative insights from V. cholerae and other bacteria suggest the following:

Comparative Functional Insights:

FeatureVibrio cholerae Na⁺-NQR Methylococcus capsulatus Na⁺-NQR
Subunit CompositionNqrA, B, C, D, E, FLikely similar, with homologs identified
Electron TransferFAD → [2Fe-2S] → FMN → riboflavin → QPresumed analogous pathway
Sodium TranslocationLinked to conformational changes in NqrB/D/E Not yet experimentally confirmed
InhibitorsKorormicin A, aurachin D No data available

Research Findings on M. capsulatus Respiratory Enzymes

Though recombinant NqrE-specific studies are sparse, transcriptional and metabolic analyses of M. capsulatus provide indirect clues:

  • Nitrogen Metabolism: Ammonia oxidation pathways in M. capsulatus involve pMMO/sMMO enzymes, which may indirectly influence Na⁺-NQR activity under varying nitrogen conditions .

  • Electron Transport Flexibility: The genome encodes 57 putative c-type cytochromes, suggesting a highly adaptable respiratory chain .

  • Thermotolerance: Growth at 37–50°C implies stable enzyme function under thermal stress .

Challenges in Characterizing Recombinant NqrE

  • Structural Data: Cryo-EM and X-ray structures of Na⁺-NQR in V. cholerae have not been replicated for M. capsulatus.

  • Functional Redundancy: M. capsulatus may rely on alternative sodium pumps (e.g., hydrogenases) under certain conditions , complicating isolation of NqrE-specific roles.

  • Inhibitor Specificity: Korormicin A and aurachin D selectively target V. cholerae Na⁺-NQR ; analogous inhibitors for M. capsulatus are unidentified.

Future Directions

  • Heterologous Expression: Cloning and purification of recombinant NqrE could elucidate its structural/functional properties.

  • Metabolomic Profiling: Link sodium translocation to methane oxidation efficiency under varying nitrogen sources .

  • Comparative Genomics: Identify nqrE regulatory elements and cofactor-binding residues across methanotrophs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
nqrE; MCA2385; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
nqrE
Target Protein Sequence
MEAYINLFIKSVFIENMALSFFLGMCTFIAVSKKIETAVGLGIAVVIVQTLTVPANNLIY TYLLKEGALSWAGLHDVDLSFIALMACIGVIAAMVQILEMVLDKFFPALYNALGIFLPLI TVNCAILAGSLFMIERDYNFSESVVYGVGSGFGWALAITAMAGVREKLKYSDVPAGLRGL GITFISAGLMALGFMAFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: mca:MCA2385

STRING: 243233.MCA2385

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylococcus capsulatus and why is it significant in metabolic research?

Methylococcus capsulatus (Bath) is a methane-oxidizing gamma-proteobacterium that has been extensively studied since its initial isolation by Foster and Davis in 1966. This obligate methanotroph holds significant importance in carbon cycle research and has applications in single-cell protein (SCP) production . Its unique metabolism allows it to use methane as its sole carbon and energy source, making it a model organism for studying C1 metabolism.

M. capsulatus features a complex metabolic network consisting of 879 metabolites connected through 913 reactions, with 730 genes mapped to these processes . The organism's versatile metabolism makes it particularly valuable for understanding methane utilization pathways and electron transport mechanisms in bacteria.

What is the general role of NADH dehydrogenases in M. capsulatus metabolism?

NADH dehydrogenases, including NDH-1, NDH-2, and NQR (NADH-quinone reductase), play crucial roles in M. capsulatus electron transport chains. These enzymes feed electrons into the ubiquinone (Q8) pool, which is essential for various metabolic processes including methane oxidation .

In M. capsulatus, NADH dehydrogenases are particularly important because they connect various oxidative pathways to energy conservation mechanisms. For example, reactions that oxidize formaldehyde to CO₂, including dye-linked formaldehyde dehydrogenase (DL-FALDH) and formate dehydrogenase (FDH), feed electrons into the Q8 pool through these NADH dehydrogenases .

How does electron transport function in the context of methane oxidation in M. capsulatus?

M. capsulatus utilizes three possible modes of electron transfer to support methane oxidation via the particulate methane monooxygenase (pMMO):

  • Redox-arm mode: The methanol dehydrogenase (MDH) transfers electrons via cytochrome c555 and c553 to terminal oxidases, contributing to proton motive force (PMF) generation. Meanwhile, pMMO draws electrons from the ubiquinone pool, which is replenished by downstream oxidation reactions .

  • Direct coupling mode: Electrons from methanol oxidation are transferred directly to pMMO without passing through the ubiquinone pool .

  • Uphill electron transfer mode: Electrons from methanol dehydrogenase feed back into the ubiquinol pool through reverse electron flow .

These electron transport mechanisms highlight the importance of redox cycling enzymes like the Na(+)-translocating NADH-quinone reductase in maintaining proper electron flow through M. capsulatus metabolism.

How does the Na(+)-translocating NADH-quinone reductase integrate with the unique central carbon metabolism of M. capsulatus?

The Na(+)-translocating NADH-quinone reductase (NQR) functions within a complex metabolic network in M. capsulatus. The organism primarily assimilates carbon through the ribulose monophosphate (RuMP) pathway, which exists in four variants, all represented in the metabolic model of M. capsulatus .

NQR likely plays a critical role in maintaining redox balance during carbon assimilation by oxidizing NADH generated in central metabolic pathways. This is particularly important in M. capsulatus because its unique methane oxidation and carbon assimilation pathways create distinct patterns of electron flow compared to heterotrophic bacteria .

Research investigating nqrE should consider how this subunit's function relates to:

  • The balance between different RuMP pathway variants

  • The partial serine pathway for formaldehyde assimilation

  • The complete Calvin-Benson-Bassham cycle encoded in the genome

Understanding these interactions requires advanced metabolic flux analysis and electron transport chain studies using both in vivo and in vitro approaches.

What structural and functional characteristics distinguish the nqrE subunit from other components of the NQR complex?

Researchers investigating nqrE should explore:

  • The number and arrangement of transmembrane helices

  • Conserved residues involved in Na+ coordination

  • Potential interactions with other NQR subunits

  • Cofactor binding sites that may participate in electron transfer

Structural studies using techniques such as X-ray crystallography or cryo-electron microscopy, combined with site-directed mutagenesis of conserved residues, would provide valuable insights into the unique properties of M. capsulatus nqrE.

How might the three different electron transfer modes in M. capsulatus affect the function of NQR and specifically the nqrE subunit?

The three electron transfer modes identified in M. capsulatus (redox-arm, direct coupling, and uphill electron transfer) likely create different demands on the NQR complex .

In the redox-arm mode, NQR may primarily function in maintaining redox balance by oxidizing NADH generated from formaldehyde and formate oxidation. During direct coupling, when electrons flow directly from methanol dehydrogenase to pMMO, the role of NQR might shift toward supporting other cellular processes. In uphill electron transfer mode, NQR could potentially work in reverse, although this would depend on thermodynamic constraints and the specific properties of the M. capsulatus NQR complex.

Research examining these interactions should consider:

  • The effect of different growth conditions (copper concentration, oxygen limitation) on NQR expression and activity

  • How nqrE mutations affect the distribution of electron flow between different pathways

  • The energetic implications of Na+ transport coupled to different electron transfer modes

What role might Na(+)-translocating NADH-quinone reductase play in energy conservation during different growth states?

The Na(+)-translocating NADH-quinone reductase likely contributes to energy conservation in M. capsulatus by coupling NADH oxidation to Na+ transport, establishing a sodium gradient across the membrane. This gradient could supplement the proton motive force generated by other respiratory enzymes.

The growth-associated maintenance (GAM) requirements of M. capsulatus are estimated at 23.087 mmol ATP gDW⁻¹ h⁻¹, while the non-growth associated maintenance (NGAM) is estimated at 8.39 mmol ATP gDW⁻¹ h⁻¹ . These energy requirements must be met through electron transport chain activity, suggesting NQR may play a more significant role during high metabolic activity states.

Research investigating nqrE's role in energy conservation should examine:

  • The effect of nqrE mutations on growth rates and yield

  • Changes in Na+ and H+ gradients in nqrE-deficient strains

  • ATP yields during growth on methane versus other carbon sources

  • The relationship between NQR activity and maintenance energy requirements

What genetic engineering strategies are most effective for studying nqrE function in M. capsulatus?

Recent advancements in CRISPR/Cas9 genome editing systems for methanotrophs provide powerful tools for investigating nqrE function. As demonstrated with M. capsulatus Bath, efficient gene deletions and insertions can be achieved using CRISPR/Cas9 in combination with homology-directed repair .

The protocol for applying CRISPR/Cas9 to study nqrE would include:

  • Design of guide RNA (sgRNA) targeting the nqrE gene

  • Construction of a CRISPR/Cas9 plasmid containing:

    • The cas9 gene under control of an appropriate promoter

    • The sgRNA sequence

    • Homology arms flanking the target region

  • Conjugation of the plasmid into M. capsulatus using techniques such as those described by Martin and Murrell

  • Screening for mutants using PCR with specific flanking primers and confirmation by Sanger sequencing

For optimal results, researchers should consider:

  • Testing various PAM sequences and guide RNA spacer sequences

  • Using homology arms of variable length (500-1000 bp typically provides good efficiency)

  • Adjusting the duration of mating during conjugation

  • Testing promoters of different strengths to control expression of cas9 and sgRNA

What expression systems are suitable for producing recombinant nqrE from M. capsulatus for biochemical characterization?

For biochemical characterization of nqrE, researchers need to express the protein in a system that allows proper folding and insertion into membranes. Several approaches can be considered:

  • Homologous expression: Expressing nqrE with an affinity tag in M. capsulatus itself using inducible promoters. This approach preserves the native membrane environment but may yield limited protein quantities.

  • Heterologous expression in other methanotrophs: Expression in related organisms like Methylocystis parvus OBBP, which has been shown to be amenable to genetic manipulation via CRISPR/Cas9 systems .

  • E. coli-based expression: Using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), combined with suitable fusion partners to enhance stability.

For any expression system, researchers should:

  • Optimize codon usage for the host organism

  • Consider using fusion tags that aid in folding and purification

  • Test different detergents for solubilization and purification

  • Validate protein functionality through activity assays

How can researchers design experiments to distinguish the specific contribution of nqrE to electron transport versus other NADH dehydrogenases in M. capsulatus?

Distinguishing the specific contribution of nqrE requires careful experimental design due to the presence of multiple NADH dehydrogenases (NDH-1, NDH-2, and NQR) in M. capsulatus . An effective experimental approach would include:

  • Generation of clean knockout mutants: Using CRISPR/Cas9 to create single, double, and triple mutants lacking various combinations of NADH dehydrogenases .

  • Complementation studies: Reintroducing wild-type or mutated versions of nqrE to evaluate restoration of function.

  • Inhibitor studies: Using specific inhibitors of different NADH dehydrogenases to isolate the contribution of each enzyme.

  • Membrane vesicle experiments: Preparing inverted membrane vesicles to measure Na+-dependent NADH:quinone oxidoreductase activity with and without specific inhibitors.

  • In vivo electron flux measurements: Using isotope labeling and metabolic flux analysis to track electron flow through different pathways in wild-type and mutant strains.

Table 1: Experimental approaches to distinguish nqrE function from other NADH dehydrogenases

ApproachAdvantagesLimitationsKey Measurements
Gene knockoutsDefinitive removal of functionPotential compensatory changesGrowth rates, metabolic fluxes, ATP yields
Inhibitor studiesRapid, reversible inhibitionPotential off-target effectsNADH oxidation rates, quinone reduction rates
Membrane vesicle assaysIsolated system for direct measurementsLoss of cellular contextNa+ transport rates, pH changes, NADH oxidation
Metabolic flux analysisSystem-wide view of electron flowComplex data interpretation13C-labeling patterns, metabolite concentrations

What parameters should be optimized when establishing a heterologous expression system for M. capsulatus nqrE?

When establishing a heterologous expression system for nqrE, researchers should optimize:

  • Conjugation efficiency: For introducing expression plasmids into M. capsulatus or other methanotrophs, parameters such as donor/recipient ratio (optimally 1:1 by OD) and mating duration (typically 48 hours) should be optimized .

  • Selection conditions: Appropriate antibiotics and concentrations for selecting transconjugants should be determined, with growth on NMS Bacto agar plates typically requiring 2 weeks of incubation .

  • Promoter selection: The choice of promoter significantly affects expression levels. For nqrE expression, researchers might consider the methanol dehydrogenase promoter, which has been used successfully for expressing other proteins in methanotrophs .

  • Growth conditions: Methane concentration, copper levels, and temperature significantly affect methanotroph physiology and protein expression. M. capsulatus Bath is typically grown at 37°C with methane as the carbon source .

  • Induction timing: For inducible promoters, determining the optimal cell density and growth phase for induction is critical for maximizing protein yield while maintaining cell viability.

How should researchers design kinetic experiments to characterize the enzymatic properties of recombinant nqrE?

Kinetic characterization of recombinant nqrE requires careful experimental design considering its role as part of the multisubunit NQR complex. Researchers should consider:

  • Enzyme preparation: Determine whether to study purified nqrE subunit alone, reconstituted NQR complex, or membrane preparations containing the complex.

  • Substrate concentration ranges: For NADH as the electron donor, use concentrations spanning at least an order of magnitude above and below the expected Km (typically 10 μM - 1 mM).

  • Quinone selection: Test physiologically relevant quinones (ubiquinone-8 is present in M. capsulatus) and potentially artificial electron acceptors like ferricyanide.

  • Na+ dependence: Vary Na+ concentrations to establish the relationship between Na+ concentration and enzyme activity, using K+ as a control.

  • Temperature and pH optimization: M. capsulatus grows optimally at 37°C, so enzymatic assays should include this temperature, but a range should be tested to determine the temperature optimum for the enzyme.

  • Inhibitor studies: Test known NQR inhibitors (e.g., HQNO, korormicin) to confirm that the recombinant enzyme maintains expected inhibitor sensitivity.

What controls are essential when analyzing the impact of nqrE mutations on M. capsulatus physiology?

When analyzing the impact of nqrE mutations, essential controls include:

  • Wild-type comparison: Always include the parent strain grown under identical conditions.

  • Complementation controls: Reintroduce the wild-type nqrE gene to confirm that observed phenotypes are due to nqrE mutation rather than polar effects or secondary mutations.

  • Growth condition controls: Test multiple growth conditions, including variations in methane concentration, oxygen levels, and copper availability, as these affect electron transport chain composition .

  • Metabolic state controls: Compare both exponential and stationary phase cultures, as energy requirements differ (reflected in different GAM and NGAM values) .

  • Technical controls for CRISPR/Cas9 editing: Include non-targeting sgRNA controls to account for potential Cas9 toxicity effects .

How should researchers interpret metabolic flux data in the context of nqrE function?

Interpreting metabolic flux data related to nqrE function requires considering the complex interplay between electron transport and central metabolism in M. capsulatus. Researchers should:

  • Compare flux distributions between wild-type and nqrE mutants: Look for changes in flux through pathways that generate or consume NADH, particularly:

    • The ribulose monophosphate (RuMP) pathway, which exists in four variants in M. capsulatus

    • Formaldehyde and formate oxidation pathways that feed electrons into the quinone pool

    • The three possible electron transfer modes to pMMO (redox-arm, direct coupling, and uphill electron transfer)

  • Evaluate energy parameters: Assess changes in growth yield, maintenance energy requirements (GAM and NGAM), and ATP production rates .

  • Consider compensatory mechanisms: Analyze upregulation of alternative NADH dehydrogenases (NDH-1, NDH-2) or changes in expression of other components of the electron transport chain.

  • Account for growth rate effects: Normalize flux data appropriately, as the GAM value is expected to increase with the growth rate of cells .

What approaches can help resolve contradictory findings regarding nqrE function in different experimental systems?

When facing contradictory findings regarding nqrE function, researchers should:

  • Systematically compare experimental conditions: Different results might be explained by variations in:

    • Growth conditions (copper concentration, oxygen tension, growth phase)

    • Genetic background (lab-adapted strains may accumulate mutations)

    • Experimental methodologies (in vivo vs. in vitro approaches)

  • Develop integrative models: Use genome-scale metabolic models like the one developed for M. capsulatus (879 metabolites, 913 reactions, 730 genes) to simulate different scenarios and test hypotheses about nqrE function.

  • Conduct epistasis analysis: Create double mutants lacking nqrE and other components of electron transport to uncover functional relationships.

  • Employ multiple complementary techniques: Combine genetic, biochemical, and systems-level approaches to build a more comprehensive understanding of nqrE function.

  • Consider environmental context: M. capsulatus may employ different electron transport strategies depending on environmental conditions, so apparently contradictory results may represent physiological flexibility.

How can researchers distinguish direct from indirect effects when characterizing nqrE mutants?

Distinguishing direct from indirect effects when characterizing nqrE mutants requires:

  • Time-resolved studies: Examine immediate responses to nqrE deletion or inhibition before compensatory mechanisms engage.

  • Conditional expression systems: Use inducible or repressible nqrE expression to observe acute effects of changing nqrE levels.

  • Specific activity measurements: Compare whole-cell phenotypes with direct biochemical measurements of NQR activity in membrane preparations.

  • Transcriptomic and proteomic analysis: Identify changes in gene expression and protein levels that may represent indirect responses to nqrE mutation.

  • Targeted metabolomics: Focus on key metabolites that directly interact with the NQR system (NADH, quinones) versus those that may change due to downstream effects.

  • In silico predictions: Use the genome-scale metabolic model of M. capsulatus to predict the theoretical direct impacts of nqrE deletion and compare with experimental observations .

What are promising approaches for investigating the structural basis of Na+ specificity in M. capsulatus nqrE?

Future research on the structural basis of Na+ specificity in nqrE should consider:

  • Cryo-electron microscopy: This technique has revolutionized membrane protein structural biology and could provide high-resolution structures of the complete NQR complex.

  • Site-directed mutagenesis: Using the CRISPR/Cas9 system developed for M. capsulatus , researchers can create point mutations in residues predicted to be involved in Na+ coordination.

  • Molecular dynamics simulations: Computational approaches can help understand Na+ binding and transport through nqrE's structure once basic structural information is available.

  • Ion selectivity assays: Developing assays to measure Na+ versus K+ selectivity in reconstituted systems would provide functional validation of structural insights.

  • Evolutionary analysis: Comparative genomics across methanotrophs and other bacteria with Na+-translocating NQR can identify conserved residues likely involved in Na+ specificity.

How might understanding nqrE function contribute to metabolic engineering of M. capsulatus for biotechnological applications?

Understanding nqrE function could advance metabolic engineering of M. capsulatus by:

  • Enhancing bioenergetic efficiency: Optimizing NQR function might improve energy conservation during methane oxidation, potentially increasing growth yield and biomass production for applications like single-cell protein (SCP) .

  • Improving oxidative stress tolerance: As NQR contributes to redox balance, engineered variants might help cells better manage oxidative stress during high-density cultivation.

  • Facilitating alternate electron acceptor use: Modified NQR systems might enable more flexible electron transport chains that can function under microaerobic or anaerobic conditions.

  • Redirecting carbon flux: Changes in electron transport efficiency could alter the NADH/NAD+ ratio, indirectly influencing carbon flux through central metabolic pathways like the RuMP cycle variations .

  • Enabling new process configurations: Understanding Na+ bioenergetics opens possibilities for cultivation systems that leverage sodium gradients instead of or in addition to proton gradients.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.