Recombinant Methylococcus capsulatus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoA; MCA1359; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
nuoA
Target Protein Sequence
MSSAGVPHTDLWPLLLYFELVLVVVGTMLALPPFLGERRTRRTPATEQPYESGIVAVGSS QLRFSVRFYLIAIFFVIFDLEAVFIFAWAIAFRESGWPGYIEILIFIGVLVATLVYLWRI GALDWRTPRQRSIEATIHQ
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving energy as a proton gradient.
Database Links

KEGG: mca:MCA1359

STRING: 243233.MCA1359

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase in M. capsulatus metabolism?

NADH-quinone oxidoreductase serves as a critical component in the electron transport chain of M. capsulatus, contributing to energy conservation during methane oxidation. This enzyme complex couples the oxidation of NADH to the reduction of quinones, generating a proton gradient across the membrane that drives ATP synthesis. In M. capsulatus, this complex is particularly important for energy conservation as it interfaces with the organism's unique methane oxidation pathway. The enzyme's activity supports the metabolic flexibility that allows M. capsulatus to thrive as an obligate methanotroph in various environments while maintaining efficient energy production .

How does nuoA integrate within the complete NADH-quinone oxidoreductase complex?

NuoA functions as one of the membrane subunits of the NADH-quinone oxidoreductase complex. Similar to the nuoK subunit that has been better characterized, nuoA is likely involved in forming the membrane domain of the complex that participates in proton translocation. The complete NADH-quinone oxidoreductase typically consists of 14 subunits in bacteria (nuoA-N), with nuoA being one of the smallest membrane-embedded components. Within the complex architecture, nuoA is positioned to interact with other membrane subunits to form the proton-conducting channel that couples electron transfer to proton translocation across the membrane .

What expression systems are most effective for recombinant M. capsulatus nuoA production?

E. coli expression systems have proven effective for the recombinant production of M. capsulatus membrane proteins, as evidenced by the successful expression of the related nuoK subunit. When expressing nuoA, researchers should consider using E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3). Expression protocols should include optimization of induction conditions, with IPTG concentrations around 0.8 mM and reduced induction temperatures (17-27°C) to enhance proper folding of the membrane protein. The expression vector should incorporate an affinity tag (typically His-tag) positioned to avoid interference with membrane insertion, preferably at the N-terminus as demonstrated with nuoK .

What purification strategy should be employed for recombinant nuoA?

Purification of recombinant nuoA requires specialized approaches due to its hydrophobic nature as a membrane protein. Based on protocols for similar proteins:

  • Cell lysis should be performed with detergent-based buffers containing mild detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG).

  • Initial purification using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin to capture the His-tagged protein.

  • Size-exclusion chromatography as a polishing step to isolate properly folded protein and remove aggregates.

  • Throughout purification, protein stability should be maintained using buffers containing 10-15% glycerol and appropriate detergent concentrations above the critical micelle concentration.

Final product purity should exceed 90% as assessed by SDS-PAGE, consistent with quality standards for structural and functional studies .

What storage conditions maintain recombinant nuoA stability?

For optimal stability of purified recombinant nuoA:

  • Short-term storage (up to one week): Store at 4°C in Tris/PBS-based buffer with detergent.

  • Long-term storage: Lyophilize the protein or store in buffer containing 6% trehalose or 30-50% glycerol at -20°C/-80°C.

  • Avoid repeated freeze-thaw cycles as these significantly reduce protein activity.

  • When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, then add glycerol to a final concentration of 30-50% for aliquoting and storage.

These conditions help preserve the structural integrity and functional activity of the membrane protein for extended periods .

How can researchers investigate the role of nuoA in M. capsulatus electron transfer mechanisms?

To investigate nuoA's role in electron transfer, researchers should employ a multi-faceted approach:

  • Site-directed mutagenesis of conserved residues in nuoA to identify amino acids critical for electron transfer or proton translocation.

  • Reconstitution of purified nuoA with other subunits in liposomes to measure proton pumping activity.

  • Electrochemical measurements using protein film voltammetry to characterize electron transfer kinetics.

  • Comparison of electron transfer efficiency between wild-type and nuoA-modified strains using oxygen consumption assays.

This approach allows for correlation of nuoA structure with the three proposed modes of electron transfer in M. capsulatus: direct coupling, uphill electron transfer, and reverse electron transfer. Measured O₂/CH₄ consumption ratios can be compared with those predicted by genome-scale metabolic models to validate the role of nuoA in specific electron transfer modes .

What is the relationship between nuoA and the unique methane oxidation pathways in M. capsulatus?

The relationship between nuoA and methane oxidation in M. capsulatus involves intricate energetic coupling:

How do post-translational modifications affect nuoA function in M. capsulatus?

Post-translational modifications of nuoA remain largely unexplored but potentially critical to function. Researchers should:

  • Use mass spectrometry-based proteomics to identify phosphorylation, acetylation, or other modifications on nuoA isolated from native M. capsulatus.

  • Compare modification patterns between different growth conditions (varying nitrogen sources, oxygen tensions, etc.) to identify regulated modifications.

  • Generate site-specific mutants that mimic or prevent identified modifications to assess functional consequences.

  • Apply omics approaches similar to those used in other bacterial systems to correlate modifications with changes in metabolism or stress responses.

These investigations would provide insights into how M. capsulatus regulates electron transfer through post-translational control of Complex I components under different environmental conditions .

How should researchers analyze transcriptomic data to understand nuoA regulation?

Analysis of transcriptomic data for nuoA regulation should follow these methodological steps:

  • Design RNA-seq experiments with appropriate replicates (minimum three biological replicates) comparing different growth conditions relevant to nuoA function.

  • Normalize RNA-seq data using transcripts per million (TPM) method to accurately compare expression levels across conditions.

  • Identify differential expression with statistical thresholds (typically ≥2-fold change with p<0.05 after Benjamini-Hochberg correction).

  • Analyze co-expression patterns between nuoA and other genes in the electron transport chain to identify regulatory networks.

The resulting data should be visualized on the M. capsulatus metabolic pathways using tools like Pathway Tools software with Omics Viewer functionality to contextualize expression changes within the broader metabolic network. This approach allows identification of condition-specific regulatory mechanisms controlling nuoA expression in response to environmental changes .

What bioinformatic tools are most suitable for analyzing nuoA protein interactions?

For analyzing nuoA protein interactions, researchers should employ:

  • STRING database analysis with confidence score filtering (≥700) to identify high-confidence interaction partners.

  • Cytoscape visualization of protein interaction networks, overlaying expression data to identify co-regulated interaction partners.

  • Molecular docking simulations to predict specific interaction interfaces between nuoA and other components of the NADH-quinone oxidoreductase complex.

  • Comparative analysis of nuoA interactions across different methanotrophs to identify conserved and species-specific interactions.

This multi-faceted approach provides a systems-level understanding of how nuoA functions within protein complexes and identifies potential regulatory interactions that might be targeted for functional studies .

How can researchers incorporate nuoA into genome-scale metabolic models of M. capsulatus?

To effectively incorporate nuoA into genome-scale metabolic models:

  • Curate nuoA-associated reactions based on experimental evidence of substrates, products, and stoichiometry.

  • Constrain the model with experimentally determined O₂/CH₄ ratios to accurately represent electron flow through the NADH-quinone oxidoreductase complex.

  • Perform flux balance analysis with varying objective functions to assess the contribution of nuoA to different metabolic outcomes.

  • Validate model predictions with experimental measurements of growth rates and metabolite production in wild-type versus nuoA-modified strains.

The existing genome-scale metabolic model for M. capsulatus (iMcBath) provides a valuable framework for these analyses, as it already includes 913 reactions and 879 metabolites with comprehensive annotations. This model can be refined to specifically investigate the contribution of nuoA to the three proposed mechanisms of electron transfer: direct coupling, uphill electron transfer, and reverse electron transfer .

How can researchers overcome low expression yields of recombinant nuoA?

To address low expression yields of recombinant nuoA:

  • Optimize codon usage for the expression host by synthesizing a codon-optimized gene version.

  • Test multiple expression strains specifically designed for membrane proteins (C41, C43, Lemo21).

  • Optimize growth and induction conditions:

    • Reduce induction temperature to 17°C

    • Use lower IPTG concentrations (0.2-0.5 mM)

    • Extend induction time to 8-12 hours

  • Consider fusion partners that enhance membrane protein expression and folding (e.g., GFP, MBP).

  • Implement simulated microgravity (SMG) culture conditions, which have been shown to enhance recombinant protein production through upregulation of protein synthesis and folding pathways.

These approaches address the common challenges of membrane protein toxicity and misfolding that often limit expression yields .

What strategies help resolve protein aggregation during nuoA purification?

To minimize aggregation during nuoA purification:

  • Screen multiple detergents for solubilization:

    DetergentConcentration RangeAdvantages
    DDM1-2% for solubilization, 0.02-0.05% for purificationMild, widely used for membrane proteins
    LMNG0.5-1% for solubilization, 0.01% for purificationEnhanced stability for many membrane proteins
    Digitonin0.5-1%Preserves protein-protein interactions
  • Include stabilizing additives in purification buffers:

    • Glycerol (10-20%)

    • Specific lipids matching M. capsulatus membrane composition

    • Low concentrations of substrates or substrate analogs

  • Optimize buffer conditions:

    • Test pH range (7.0-8.0)

    • Vary salt concentration (100-500 mM)

    • Include reducing agents (1-5 mM DTT or TCEP)

  • Employ gentle purification techniques:

    • Use gravity flow rather than pressure for column chromatography

    • Maintain samples at 4°C throughout purification

    • Avoid concentrating samples above 1-2 mg/mL

These strategies help maintain the native conformation of nuoA during purification by minimizing exposure to conditions that promote aggregation .

How should researchers validate the functional activity of purified recombinant nuoA?

To validate functional activity of purified recombinant nuoA:

  • Reconstitution assays:

    • Incorporate purified nuoA into proteoliposomes

    • Measure proton pumping activity using pH-sensitive fluorescent dyes

    • Assess interaction with other nuo subunits through co-reconstitution experiments

  • Spectroscopic analyses:

    • Circular dichroism to confirm proper secondary structure

    • Fluorescence spectroscopy to assess tertiary structure and substrate binding

    • EPR spectroscopy to examine potential redox centers

  • Complementation studies:

    • Express recombinant nuoA in nuoA-deficient bacterial strains

    • Measure restoration of NADH oxidase activity

    • Assess growth phenotypes under conditions requiring functional Complex I

  • Comparative analyses:

    • Compare biochemical properties with those of native nuoA purified from M. capsulatus

    • Analyze differences between recombinant nuoA expressed in different host systems

This multi-faceted approach ensures that the recombinant protein not only has the correct structure but also retains the functional properties necessary for meaningful mechanistic studies of electron transfer in M. capsulatus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.