Recombinant Methylococcus capsulatus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; MCA1350; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
nuoK
Target Protein Sequence
MAPIPFEHALVLASVLFVLGLVALLIRRNLIVMLMSVEIMLNAAGLAFIAAGSRWGQPDG QVMFLLILTLAAAEVGVGLGLGLQVYRRHKTLDVDRLSEMQG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. The immediate electron acceptor for this enzyme is believed to be ubiquinone. The enzyme couples this redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thus conserving the redox energy in a proton gradient.
Database Links

KEGG: mca:MCA1350

STRING: 243233.MCA1350

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylococcus capsulatus Bath and why is it important for metabolic research?

Methylococcus capsulatus Bath is a model methanotroph that has been extensively studied in various research areas due to its unique metabolic capabilities. It is the only biological methane sink present in nature, playing a significant role in methane oxidation through the action of methane monooxygenase enzyme which converts methane to methanol . This bacterium has been commercially utilized for single-cell protein production using synthetic nitrogen and natural gas, as demonstrated by companies such as Norferm Danmark A/S with their BioProtein product .

The importance of M. capsulatus Bath extends to multiple domains:

  • Environmental research: As a natural methane consumer with relevance to climate change mitigation

  • Industrial applications: Production of single-cell protein and value-added chemicals

  • Metabolic engineering: Offers opportunities for optimizing bioproduction pathways

  • Fundamental research: Model organism for understanding C1 metabolism

Recent genetic engineering efforts have demonstrated its potential for producing value-added chemicals such as mevalonate, though optimization of culturing conditions remains an active area of research .

What is the NADH-quinone oxidoreductase complex and what role does subunit K play?

NADH-quinone oxidoreductase (also known as Complex I) is a crucial component of bacterial electron transport chains involved in energy production. In M. capsulatus Bath, this complex couples the oxidation of NADH to the reduction of quinones, playing a central role in establishing the proton motive force necessary for ATP synthesis.

The nuoK subunit is one of the membrane-embedded components of this complex. Based on genome-scale metabolic models of M. capsulatus Bath, the NADH-quinone oxidoreductase is involved in key redox reactions that support methane oxidation pathways . The complex may operate through both:

  • Direct coupling mechanism

  • Uphill electron transfer

Both mechanisms operate at reduced efficiency but match well with experimental observations . The nuoK subunit specifically contributes to the proton-pumping function of the complex, as it contains transmembrane helices that form part of the proton translocation pathway.

How does nitrogen metabolism intersect with electron transport in M. capsulatus?

M. capsulatus Bath demonstrates complex relationships between nitrogen metabolism and electron transport systems, which is relevant for understanding nuoK function. The bacterium can utilize different nitrogen sources including ammonium (NH₄⁺) and nitrate (NO₃⁻), with distinct metabolic responses:

Nitrogen SourcePrimary Assimilation PathwayConditionMetabolic Effect
Ammonium (NH₄⁺)Alanine dehydrogenase (ADH)>1 mM NH₄⁺Higher energy demand
Ammonium (NH₄⁺)Glutamine synthetase (GS)<1 mM NH₄⁺Alternative pathway activated
Nitrate (NO₃⁻)Nitrate reductase pathwayAll concentrationsTemperature-dependent utilization

Transcriptional analysis reveals that nitrogen source availability affects the expression of genes related to electron transport components, including NADH-quinone oxidoreductase subunits . When nitrate is used as the nitrogen source, its reduction requires electrons that may be diverted from other metabolic processes, potentially impacting the function of the electron transport chain where nuoK operates .

How should experiments be designed to study the function of recombinant nuoK in M. capsulatus?

When designing experiments to study recombinant nuoK in M. capsulatus, researchers should follow these methodological guidelines:

  • Replication: Implement proper replication to ensure statistical validity. Multiple biological replicates are essential, especially given the complex metabolism of M. capsulatus .

  • Randomization: Apply randomization in experimental setup to minimize systematic bias that could affect gene expression or protein function measurements .

  • Blocking/Grouping: Consider grouping subjects or samples to control for variables that might influence nuoK expression, such as batch effects in culture growth .

  • Multifactorial Design: Examine multiple factors simultaneously, particularly temperature and nitrogen source, as both significantly affect M. capsulatus metabolism .

  • Sequential Approach: Begin with pilot experiments to establish baseline parameters before proceeding to more complex studies of nuoK function .

For gene expression studies of recombinant nuoK, RNA-seq combined with quantitative PCR validation provides the most comprehensive assessment of transcriptional responses . For functional studies, growth experiments paired with metabolomic analysis using gas chromatography-mass spectrometry (GC-MS) can reveal how nuoK modifications affect central metabolism .

What sample size considerations are important when studying recombinant protein expression in M. capsulatus?

Determining appropriate sample size for experiments with recombinant nuoK in M. capsulatus requires careful power analysis. Consider these key principles:

  • Power and Sample Size Relationship: Sample size increases with desired statistical power. For standard experiments, aim for 80-90% power to detect meaningful differences in nuoK expression or function .

  • Effect Size Estimation: The magnitude of expected difference determines required sample size. Smaller effects require larger sample sizes. For nuoK studies, consider what magnitude of change would be biologically significant .

  • Variance Consideration: Sample size increases proportionally to variance. M. capsulatus cultures can show significant variability depending on growth conditions, requiring more replicates .

  • Test Direction: Two-sided tests (without preference for direction of change) require larger sample sizes than one-sided tests .

The formula for basic sample size calculation is:

n=2(Zα/2+Zβ)2σ2Δ2n = \frac{2(Z_{\alpha/2} + Z_{\beta})^2\sigma^2}{\Delta^2}

Where:

  • n = sample size per group

  • Z values represent critical values for significance level (α) and power (1-β)

  • σ = standard deviation

  • Δ = expected difference

For studies involving recombinant protein expression in M. capsulatus, pilot experiments measuring expression variability are crucial for estimating σ accurately .

How do environmental conditions affect nuoK expression and function in M. capsulatus?

Environmental conditions significantly impact gene expression and protein function in M. capsulatus, with particular relevance to nuoK studies:

ParameterEffect on nuoKExperimental Consideration
TemperatureExpression and activity changesTest both 37°C and 45°C conditions
Nitrogen sourceTranscriptional changes in respiratory genesCompare ammonia vs. nitrate conditions
Methane concentrationAffects electron flow through respiratory chainMaintain consistent methane levels
Copper availabilityInfluences methane oxidation pathway choiceMonitor and control copper concentration

Temperature particularly influences nitrate utilization in M. capsulatus Bath, with nitrate usage being temperature-dependent while ammonia usage remains similar across tested temperature ranges . This suggests that experiments studying nuoK should control for both nitrogen source and temperature, as these variables interact to affect electron transport chain components.

Transcriptomic studies reveal that genes related to nitrogen metabolism, particularly for ammonia oxidation, nitrate reduction, and transporters, show varying transcription levels under different conditions . This nitrogen-dependent regulation likely extends to electron transport components like nuoK.

How can genome-scale metabolic models inform research on nuoK function?

Genome-scale metabolic models (GEMs) provide powerful frameworks for studying nuoK function within the context of M. capsulatus metabolism. The existing GEM for M. capsulatus Bath spans 879 metabolites connected via 913 reactions, with 730 genes included . This model serves both as a predictive tool and a centralized knowledge base.

Researchers can utilize GEMs to:

  • Predict Phenotypic Effects: Simulate the metabolic consequences of nuoK modifications by altering constraints on relevant reactions.

  • Identify Metabolic Bottlenecks: Determine if nuoK function limits specific metabolic pathways under various conditions.

  • Generate Testable Hypotheses: Model outputs can suggest experiments to validate predictions about nuoK's role in electron transfer.

  • Contextualize Experimental Data: Integrate transcriptomic and metabolomic data into the model to better understand system-wide effects of nuoK manipulation.

The M. capsulatus Bath model has demonstrated that methane oxidation by particulate methane monooxygenase can be driven through both direct coupling and uphill electron transfer mechanisms . Similar analysis could reveal how nuoK contributes to these processes and identify potential metabolic engineering targets.

What metabolomic approaches are most informative for studying the impact of nuoK modifications?

Metabolomic analysis provides crucial insights into how nuoK modifications affect cellular metabolism. Based on existing research with M. capsulatus Bath, the following approaches are particularly informative:

  • Gas Chromatography-Mass Spectrometry (GC-MS): This technique has successfully revealed changes in fatty acids, amino acids, central carbon intermediates, and nitrogen bases in response to different nitrogen sources and temperatures in M. capsulatus .

  • Targeted vs. Untargeted Analysis:

    • Targeted approaches: Focus on specific metabolites in central carbon metabolism and energy production pathways directly linked to electron transport

    • Untargeted approaches: Provide broader insights into system-wide metabolic shifts resulting from nuoK modifications

  • Time-Course Analysis: Capturing metabolic dynamics at multiple time points can reveal how nuoK modifications affect metabolic adaptation over time.

When designing metabolomic experiments for nuoK research, consider these methodological guidelines:

  • Include appropriate internal standards for quantification

  • Implement rapid quenching of metabolism to capture accurate snapshots

  • Combine with transcriptomic data for integrated analysis

  • Compare results under multiple environmental conditions (temperature, nitrogen source)

How can transcriptomic data be leveraged to understand nuoK regulation in different conditions?

Transcriptomic approaches, particularly RNA-seq, provide valuable insights into nuoK regulation within the broader context of M. capsulatus metabolism. Research has shown that M. capsulatus exhibits significant transcriptional responses to different nitrogen sources and temperatures .

To effectively leverage transcriptomic data for nuoK research:

  • Differential Expression Analysis: Compare nuoK expression levels across different experimental conditions to identify factors that regulate its expression.

  • Co-expression Network Analysis: Identify genes with similar expression patterns to nuoK, potentially revealing functional relationships and regulatory mechanisms.

  • Pathway Enrichment Analysis: Determine which metabolic pathways show coordinated expression changes alongside nuoK.

  • Validation with qPCR: Confirm transcriptomic findings regarding nuoK expression using quantitative PCR, which has been successfully employed to validate transcriptional changes in M. capsulatus .

When designing transcriptomic experiments:

  • Include multiple biological replicates (minimum 3 per condition)

  • Consider the effect of both temperature and nitrogen source on gene expression

  • Implement proper controls for normalization

  • Correlate transcriptomic data with metabolomic and physiological measurements

How should researchers approach contradictory data regarding nuoK function?

When encountering contradictory data regarding nuoK function, follow this methodological approach:

  • Thorough Data Examination: Carefully examine all data to identify specific discrepancies and patterns that contradict the initial hypothesis. Compare findings with existing literature and pay special attention to outliers that may have influenced results .

  • Identify Specific Discrepancies: Compare expected results with actual findings to pinpoint inconsistencies. This process should be approached systematically and without bias .

  • Evaluate Initial Assumptions: Reassess the fundamental assumptions underpinning your research questions about nuoK function. Consider whether the observed contradictions might stem from flawed assumptions rather than methodological issues .

  • Consider Alternative Explanations: Develop multiple hypotheses that could explain the contradictory results. For example, unexpected nuoK function results might be explained by:

    • Post-translational modifications affecting protein function

    • Interaction with other respiratory components not initially considered

    • Environmental conditions altering electron transport mechanisms

    • Regulatory feedback affecting nuoK expression or activity

  • Refine Variables and Controls: Implement additional controls and refine variables in follow-up experiments to resolve contradictions .

Remember that unexpected results often lead to the most significant scientific advancements. M. capsulatus Bath research has shown that this organism employs complex, sometimes redundant metabolic pathways that may result in seemingly contradictory experimental outcomes .

What statistical considerations are important when analyzing nuoK expression data?

When analyzing nuoK expression data from M. capsulatus experiments, several statistical considerations are crucial:

  • Distribution Assessment: Determine whether expression data follows normal or non-Gaussian distributions. Non-normal distributions require appropriate non-parametric statistical methods .

  • Variance Analysis: Assess homogeneity of variance across experimental groups. Heterogeneous variance may require data transformation or alternative statistical approaches .

  • Multiple Testing Correction: When analyzing expression across multiple conditions or timepoints, implement appropriate corrections (e.g., Benjamini-Hochberg procedure) to control false discovery rate .

  • Effect Size Estimation: Calculate standardized effect sizes to quantify the magnitude of observed changes in nuoK expression, which is more informative than p-values alone .

  • Power Analysis Post-Hoc: Evaluate whether your study achieved sufficient statistical power to detect biologically meaningful differences in nuoK expression .

  • Appropriate Statistical Tests for Different Experimental Designs:

Experimental DesignAppropriate Statistical Test
Two conditions, normal distributionStudent's t-test
Two conditions, non-normal distributionMann-Whitney U test
Multiple conditions, one factorANOVA with post-hoc tests
Multiple conditions, multiple factorsFactorial ANOVA
Repeated measuresRepeated measures ANOVA or mixed models

How can researchers integrate multi-omics data to understand nuoK's role in M. capsulatus metabolism?

Integrating multi-omics data provides a comprehensive understanding of nuoK's role within M. capsulatus metabolism. Based on existing research approaches with this organism, the following integration strategies are recommended:

  • Correlation Analysis: Identify correlations between nuoK expression levels (transcriptomics), protein abundance (proteomics), and metabolite concentrations (metabolomics), particularly focusing on compounds involved in energy metabolism .

  • Pathway Mapping: Map multi-omics data onto known metabolic pathways, especially those involving electron transport and nitrogen metabolism, which have been shown to interact in M. capsulatus .

  • Flux Balance Analysis: Incorporate multi-omics data as constraints in genome-scale metabolic models to predict metabolic flux distributions under different conditions and nuoK expression levels .

  • Network Analysis: Construct integrated networks representing relationships between genes, proteins, and metabolites to identify key regulatory nodes and potential intervention points.

  • Time-Course Integration: Analyze temporal dynamics across multiple omics layers to understand how nuoK-related perturbations propagate through the metabolic network over time.

A particularly powerful approach combines transcriptomics with metabolomics, as demonstrated in M. capsulatus research where changes in gene expression related to nitrogen metabolism correlated with shifts in intracellular metabolites including fatty acids, amino acids, and central carbon intermediates .

What are common challenges in expressing recombinant proteins in M. capsulatus and how can they be addressed?

Expressing recombinant proteins such as nuoK in M. capsulatus presents several challenges that require specific troubleshooting approaches:

  • Growth Condition Optimization: M. capsulatus requires carefully controlled temperature and nitrogen conditions. Research has shown that growth responses vary significantly based on nitrogen source (nitrate vs. ammonium) and temperature (optimal range 37-45°C) .

    Solution: Systematically test combinations of temperatures and nitrogen sources to identify optimal conditions for recombinant protein expression. For nuoK specifically, consider that nitrate usage is temperature-dependent while ammonium usage remains similar across temperatures .

  • Expression System Selection: Choosing appropriate promoters and regulatory elements that function effectively in M. capsulatus.

    Solution: Utilize promoters derived from highly expressed genes in M. capsulatus, particularly those related to methane metabolism which tend to show strong expression under standard growth conditions.

  • Protein Folding and Membrane Integration: As nuoK is a membrane protein, ensuring proper folding and integration into the membrane is particularly challenging.

    Solution: Consider using native signal sequences and fusion partners that facilitate membrane targeting. Monitor protein localization through fractionation experiments and Western blotting.

  • Metabolic Burden: Recombinant protein expression can create a metabolic burden that affects growth and native protein production.

    Solution: Implement inducible expression systems and carefully titrate expression levels to balance recombinant protein yield with cellular health.

How can researchers optimize experimental conditions to study nuoK function in M. capsulatus?

Optimizing experimental conditions for studying nuoK function requires attention to several key parameters:

  • Temperature Control: M. capsulatus exhibits distinct metabolic responses at different temperatures, with nitrate utilization being particularly temperature-dependent .

    Recommendation: Conduct experiments at both 37°C and 45°C to capture the full range of metabolic responses, especially when studying electron transport components like nuoK.

  • Nitrogen Source Selection: The choice between ammonium and nitrate significantly affects transcription of genes related to nitrogen metabolism and potentially electron transport .

    Recommendation: Compare nuoK function under both nitrogen sources, with careful attention to concentration effects (e.g., <1mM vs. >1mM for ammonium).

  • Oxygen Tension: As an enzyme involved in respiration, nuoK function may be affected by oxygen availability.

    Recommendation: Control oxygen levels precisely, potentially comparing function under different oxygen tensions to understand regulatory responses.

  • Copper Availability: Copper concentration affects the expression of methane monooxygenase enzymes in M. capsulatus, potentially affecting electron flow through the respiratory chain.

    Recommendation: Standardize copper concentrations in growth media and consider testing nuoK function under both high and low copper conditions.

  • Growth Phase Considerations: Metabolic profiles change significantly across growth phases.

    Recommendation: Standardize sampling points relative to growth phase rather than absolute time, and consider time-course experiments to capture dynamic changes in nuoK function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.