Recombinant Methylococcus capsulatus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Lgt performs the first step in lipoprotein maturation, enabling downstream modifications by signal peptidase II (Lsp) and apolipoprotein N-acyltransferase (Lnt). This process is essential for bacterial viability, as demonstrated by growth defects in lgt depletion strains . Key functional characteristics include:

  • Substrate specificity: Targets lipobox motifs (e.g., -Leu-Ala/Ser-Gly-Ala-Cys-) in prolipoproteins .

  • Membrane topology: Seven transmembrane helices with periplasmic N-terminus and cytoplasmic C-terminus, positioning the active site for lipid transfer .

  • Catalytic residues: Conserved residues (e.g., Y26, N146, G154 in E. coli) are critical for enzymatic activity .

Relevance in Methylococcus capsulatus

While M. capsulatus Lgt has not been directly characterized, its genome encodes homologs of lipoprotein modification enzymes . Key contextual findings:

  • Metabolic engineering: Recombinant M. capsulatus strains have been developed for industrial applications (e.g., succinic acid production), though these studies focus on central carbon metabolism rather than lipoprotein processing .

  • Capsule biosynthesis: M. capsulatus produces a polysaccharide capsule, suggesting lipoprotein-dependent membrane anchoring mechanisms analogous to E. coli colanic acid systems .

Biotechnological Implications

Lgt’s role in lipoprotein biogenesis makes it a potential target for:

  • Antibiotic development: Essentiality in pathogenic bacteria (e.g., Helicobacter pylori) highlights its therapeutic promise .

  • Industrial strain optimization: Enhancing lipoprotein-dependent secretion systems in methanotrophs for biofuel or SCP production .

Research Gaps and Future Directions

  • Direct structural characterization of M. capsulatus Lgt is needed.

  • Role of lipoproteins in methane oxidation or stress adaptation remains unexplored.

  • Engineering recombinant Lgt for altered substrate specificity could enable tailored membrane protein localization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its inclusion.
Synonyms
lgt; MCA2727; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
lgt
Target Protein Sequence
MLTYPAIDPVAVSFGPLKVHWYGLMYVIGIAATWILARRRVQRSANPLFTPAQVEDLVFY AAIGVVVGGRLGYALFYNFSGFLHDPAMLFRIWEGGMAFHGGLIGVLIAMYAYGRSQGIR FFDVADFLAPYVPIGLLAGRIGNFINGELWGKPSDLPWAMIFPHAGDVPRHPSQLYEAFL EGLVLLIILQWFSRRSPPRMAVSGLFLLGYGVFRFAVEFVRLPDVQLGYLAFGWLTMGQI LCLPMILFGIVLLAAAYARRSA
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, representing the initial step in the formation of mature lipoproteins.
Database Links

KEGG: mca:MCA2727

STRING: 243233.MCA2727

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.