Recombinant Methylococcus capsulatus Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant CrcB is produced via heterologous expression in Escherichia coli, typically fused with a His-tag for purification. Key properties include:

PropertyDescription
UniProt IDQ606P3
Gene NamecrcB (MCA1973 locus)
Protein Length228 amino acids (1-228 aa)
Expression SystemE. coli
TagHis-tag (position determined during production)
AA SequenceMNLSLFAIALGGAAGALARFWVSNGLYGWLGRDFPHGTLFINVSGSFLMGFLSVMMIQRF... (full sequence in )
Purity>90% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C

Functional Role of CrcB

CrcB is annotated as a putative fluoride ion transporter based on homology to Helicobacter pylori CrcB . In Methylococcus capsulatus, it is implicated in:

  • Stress Response: Potential involvement in ion homeostasis under environmental stressors .

  • Methanotrophic Metabolism: While not directly linked to methane oxidation pathways (e.g., RuMP or Serine pathways ), genomic analyses suggest ancillary roles in maintaining cytoplasmic ion balance during C1 metabolism .

Biotechnological Applications

  • Protein Engineering: Used as a model to study fluoride resistance mechanisms in methanotrophs .

  • Industrial Relevance: M. capsulatus is a candidate for single-cell protein (SCP) production; CrcB could optimize growth under ion-stressed conditions .

  • Research Tool: Recombinant CrcB aids in structural studies via X-ray crystallography or NMR .

Genomic Context

  • The crcB gene (MCA1973) is part of a conserved genomic region in M. capsulatus Bath, flanked by genes encoding hypothetical proteins and transporters .

  • Pan-genome analysis of Methylococcus strains revealed crcB as a core gene, present in all isolates .

Expression and Stability

  • Recombinant CrcB is sensitive to freeze-thaw cycles; glycerol (50%) is recommended for long-term storage .

  • Functional assays in E. coli suggest fluoride efflux activity, though direct evidence in M. capsulatus remains pending .

Comparative Analysis

FeatureM. capsulatus CrcBH. pylori CrcB
Length228 aa 130 aa
Ion TransportPutative fluoride transporter Confirmed fluoride efflux
Expression HostE. coli E. coli

Knowledge Gaps and Future Directions

  • Mechanistic Studies: Elucidate CrcB’s role in M. capsulatus metabolism using knockout strains .

  • Structural Resolution: Cryo-EM or crystallography to map ion channels .

  • Industrial Optimization: Engineer CrcB variants to enhance microbial resilience in bioreactors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us and we will prioritize its development.
Synonyms
crcB; MCA1973; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
crcB
Target Protein Sequence
MNLSLFAIALGGAAGALARFWVSNGLYGWLGRDFPHGTLFINVSGSFLMGFLSVMMIQRF ALAAEYRAAVLVGFLGAYTTFSTFSLETLALFEEGSLLKAALNVLLSVVLCLAAVWVGAV LARRLAVGEIAALVGGPGLRIFGAACGMSLLAGFAAALAFARAGLGPQLESLVLVALTGL VVVGTLVALVVTGTELRGAFQLWGAFTLSAFAAVVFLSLGLVLARGAG
Uniprot No.

Target Background

Function
Essential for reducing fluoride concentration within the cell, thereby minimizing its toxicity.
Database Links

KEGG: mca:MCA1973

STRING: 243233.MCA1973

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylococcus capsulatus (Bath) and why is it significant for recombinant protein research?

Methylococcus capsulatus (Bath) is a Gram-negative, obligate-aerobe gamma-proteobacterium that oxidizes methane as its primary carbon and energy source. It plays a crucial role in the global carbon cycle and has been extensively studied for its unique methane metabolism. The organism has gained significant commercial interest as a primary microbe for Single Cell Protein (SCP) production as animal feed, particularly with the increased availability of natural gas as a cheap feedstock. From a research perspective, M. capsulatus offers a valuable platform for studying C1 metabolism and the expression of specialized proteins involved in methane oxidation pathways . The availability of genome-scale metabolic models (GSMMs) for this organism further enhances its value as a research subject for recombinant protein studies .

What genomic resources are available for studying protein expression in M. capsulatus?

Researchers have access to several comprehensive genomic resources for M. capsulatus (Bath):

  • Annotated genome: The complete genome sequence published by Ward et al. (2004) provides the foundation for genetic studies .

  • Genome-scale metabolic models: Two independent GSMMs have been developed:

    • iMC535: Contains 535 genes, 899 reactions, and 865 metabolites

    • Unnamed model by Lieven et al.: Includes 730 genes, 913 reactions, and 879 metabolites

These models serve as centralized knowledge bases that help researchers predict metabolic behaviors, optimize expression conditions, and identify potential interactions that might affect recombinant protein production .

What expression systems work effectively for producing functional recombinant proteins in M. capsulatus?

For expressing recombinant proteins in M. capsulatus, researchers have successfully employed:

  • RK2-based broad-host-range expression plasmids: The pCAH01 plasmid containing the inducible tetracycline promoter/operator (PtetA) has demonstrated strong functionality in M. capsulatus .

  • Inducible promoter systems: The PtetA promoter exhibits strong inducible activation, with approximately 10-fold increase in reporter gene expression (GFP) after anhydrotetracycline (aTc) induction, making it ideal for controlled expression of potentially toxic proteins .

  • Promoter strength evaluation: Reporter systems using superfolder GFP have been effective for evaluating both heterologous and native M. capsulatus promoters prior to recombinant protein expression .

This temporal control of gene expression is particularly valuable when expressing membrane proteins like CrcB homologs, which may impact cellular viability when overexpressed.

How can CRISPR/Cas9 gene editing be applied to modify genes in M. capsulatus?

A CRISPR/Cas9 gene-editing system has been successfully developed for M. capsulatus (Bath) with several key components:

  • Expression vectors: Broad-host-range expression plasmids carrying the Streptococcus pyogenes Cas9 endonuclease and synthetic single guide RNA (gRNA) have demonstrated efficient DNA targeting and double-stranded DNA cleavage .

  • Nickase variant: The Cas9D10A nickase variant has been successful for chromosomal editing, offering an alternative approach that may reduce off-target effects .

  • Editing efficiency: When targeting the chromosomal mmoX gene with Cas9 and a specific gRNA, approximately 99% cell death was observed, demonstrating high targeting efficiency of the system .

  • Proven applications: The system has been validated for:

    • In vivo point mutations in reporter genes (converting GFP to BFP)

    • Chromosomal editing by introducing premature stop codons

    • Targeting essential genes

This technology enables precise genetic modifications for studying protein function, including targeted mutations or knockout studies of membrane proteins like CrcB homologs.

What considerations are important when designing experiments to modify potential fluoride channels like CrcB in M. capsulatus?

When designing experiments to modify membrane proteins like CrcB homologs:

  • Target selection: Carefully select target sequences with minimal off-target potential within the M. capsulatus genome.

  • Functional redundancy: CrcB homologs often function in resistance mechanisms, so researchers should consider potential redundant systems that might mask phenotypic effects of modifications .

  • Expression control: The inducible PtetA promoter system provides temporal control of expression, essential when modifying potentially essential genes .

  • Phenotypic validation: For CrcB homologs, which typically function in fluoride ion transport, experiments should include appropriate assays for fluoride sensitivity or resistance.

  • Consideration of metabolic context: Given that M. capsulatus has a unique C1 metabolism, researchers should account for potential metabolic impacts when modifying membrane transport proteins by consulting available metabolic models .

What methodological approaches are most effective for verifying gene editing outcomes in M. capsulatus?

To verify successful gene editing in M. capsulatus:

  • Fluorescent reporter systems: Validated superfolder GFP reporters provide a visual readout for expression and can be modified to confirm successful editing (e.g., GFP to BFP conversion) .

  • Phenotypic assays: For membrane proteins like CrcB homologs, functional assays examining changes in ion sensitivity or resistance provide evidence of successful modification.

  • Sequencing confirmation: Direct sequencing of the modified genomic region is essential to confirm precise editing.

  • Transcriptomic analysis: RNA-seq can confirm changes in expression patterns resulting from promoter modifications or gene knockouts.

  • Growth phenotyping: Systematic growth measurements under various conditions can reveal phenotypic effects of modifications to transport proteins.

How does the unique metabolism of M. capsulatus impact recombinant protein expression?

The distinctive metabolic pathways of M. capsulatus create a specific context for protein expression:

Metabolic FeatureImpact on Protein ExpressionExperimental Consideration
RuMP pathway variantsAffects carbon flux and energy availabilityMay require optimization of carbon source concentration
Obligate methanotrophyLimited carbon source optionsNeed for specialized culture systems with methane supply
High oxygen requirementPotential for oxidative stressCareful aeration control during expression
Unique electron transportMay affect expression of membrane proteinsConsider redox balance when expressing membrane proteins
Nitrogen metabolism flexibilityCan grow on various nitrogen sourcesOpportunity to optimize nitrogen source for protein yield

M. capsulatus operates primarily through the ribulose monophosphate (RuMP) pathway with four potential variants, all represented in metabolic models . This metabolic flexibility may affect recombinant protein expression by altering the availability of metabolic precursors and energy.

How can metabolic modeling inform experimental design for studying membrane proteins in M. capsulatus?

Genome-scale metabolic models provide valuable insights for experimental design:

  • Predicting metabolic impacts: Models can predict how expression of membrane proteins might affect cellular energy balance and metabolite fluxes .

  • Resource allocation: GSMMs help researchers understand how cellular resources are distributed, informing decisions about expression levels and conditions to maximize protein yield while maintaining cellular viability .

  • Identifying potential interactions: Models like iMC535 with 535 genes, 899 reactions, and 865 metabolites provide a comprehensive view of cellular metabolism that can highlight potential interactions between membrane proteins and metabolic pathways .

  • Strain optimization strategies: The models enable in silico testing of genetic modifications before experimental implementation, potentially saving resources when developing optimized strains for protein expression .

  • Predicting essential genes: Metabolic models have predicted approximately 29% of metabolic genes in M. capsulatus to be essential, which is critical knowledge when designing modifications to membrane protein genes that might be essential .

What growth conditions optimize recombinant protein expression in M. capsulatus?

Based on metabolic understanding and experimental observations, optimal conditions include:

  • Carbon source: Methane as the primary carbon source, with careful control of concentration to balance growth and expression .

  • Nitrogen source: M. capsulatus can grow on various nitrogen sources, including amino acids, providing flexibility for optimization .

  • Oxygen levels: As an obligate aerobe, M. capsulatus requires careful oxygen supply management, particularly important for membrane protein expression .

  • Inducer concentration: For the PtetA system, anhydrotetracycline (aTc) concentration can be optimized to achieve desired expression levels .

  • Growth phase timing: Induction at appropriate growth phases can significantly impact recombinant protein yield and functionality.

What approaches are most effective for studying the function of potential fluoride channels like CrcB in methanotrophs?

For functional characterization of membrane transport proteins in M. capsulatus:

  • Controlled expression systems: The validated PtetA inducible promoter system allows precise control of expression levels, critical for membrane proteins that may be toxic when overexpressed .

  • Ion sensitivity assays: For putative fluoride channels like CrcB homologs, fluoride sensitivity assays at varying concentrations provide functional insights.

  • Fluorescent ion indicators: Fluorescent indicators for specific ions can allow real-time monitoring of transport activity in living cells.

  • Genetic complementation: Expressing the CrcB homolog in model organisms with crcB deletions can validate functional conservation.

  • Structural prediction and mutagenesis: Combining structural bioinformatics with targeted mutagenesis of predicted functional residues can elucidate mechanism details.

How can researchers address challenges in expressing membrane proteins in M. capsulatus?

Membrane protein expression presents unique challenges that can be addressed through:

  • Careful inducer titration: The approximately 10-fold induction range of the PtetA system allows fine-tuning of expression levels to avoid toxicity .

  • Fusion partners: Adding soluble fusion partners can improve folding and stability of membrane proteins.

  • Growth temperature optimization: Lower growth temperatures often improve membrane protein folding and reduce aggregation.

  • Specialized media components: Addition of specific lipids or osmoprotectants can enhance membrane protein stability.

  • Expression timing: Inducing expression at specific growth phases can significantly improve yield and functionality of membrane proteins.

How can contradictory experimental results regarding membrane protein function be reconciled?

When facing contradictory results in membrane protein research:

  • Metabolic context consideration: The unique metabolic pathways of M. capsulatus may create context-specific protein functions that differ from homologs in other organisms .

  • Strain variation: Different laboratory strains may have accumulated mutations affecting membrane protein function.

  • Culture condition effects: Variations in growth conditions can significantly alter membrane composition and protein function.

  • Heterologous vs. native expression: Function may differ between heterologously expressed proteins and those in their native context.

  • Model validation: Using the genome-scale metabolic models to simulate experimental conditions may help identify metabolic factors contributing to contradictory results .

What emerging technologies could advance research on methanotroph membrane proteins?

Promising approaches for advancing membrane protein research in M. capsulatus include:

  • Advanced CRISPR techniques: Beyond the established CRISPR/Cas9 system, newer variants like base editors and prime editors could enable more precise modifications without double-strand breaks .

  • Single-cell technologies: Single-cell transcriptomics and proteomics could reveal cell-to-cell variation in membrane protein expression and function.

  • Cryo-EM structural analysis: This technique is increasingly accessible for determining membrane protein structures without crystallization.

  • Microfluidic cultivation: Provides precise control over the microenvironment for methanotrophs, enabling more reproducible studies.

  • Synthetic biology circuits: Development of genetic circuits in M. capsulatus could enable more sophisticated control over membrane protein expression and function.

How might cross-species gene regulatory mechanisms inform CrcB research in M. capsulatus?

Understanding cross-species regulatory mechanisms provides valuable context:

  • Conservation of homologous genes: Tools like GeneCompass have demonstrated that both prior knowledge and self-supervised pre-training contribute to cross-species homology identification, with the latter playing a major role .

  • Regulatory network inference: Insights from gene regulatory networks in model organisms can inform hypotheses about the regulation of CrcB homologs in M. capsulatus.

  • In silico gene deletion: Computational studies have shown that gene deletion experiments can validate gene regulatory relationships , suggesting similar approaches could elucidate CrcB regulation.

  • Cross-species validation: Testing CrcB function across multiple methanotroph species can distinguish conserved functions from species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.