Recombinant Methylococcus capsulatus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Undecaprenyl-diphosphatase (UppP) catalyzes the hydrolysis of undecaprenyl diphosphate to undecaprenyl phosphate, a critical step in bacterial cell wall synthesis . This reaction is essential for recycling lipid carriers during peptidoglycan and teichoic acid biosynthesis. UppP also confers resistance to bacitracin by maintaining undecaprenyl phosphate pools .

  • Reaction:

    Undecaprenyl diphosphate+H2OUndecaprenyl phosphate+Phosphate\text{Undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{Undecaprenyl phosphate} + \text{Phosphate}

    The enzyme requires divalent cations like Ca²⁺ for activity .

Recombinant UppP Production

Recombinant UppP proteins from other bacterial species have been characterized:

PropertyAzospirillum brasilense UppP Escherichia coli O157:H7 UppP
HostE. coliYeast
TagN-terminal HisUndetermined
LengthFull-length (1-187 aa)Partial
Purity>90% (SDS-PAGE)>85% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized)-20°C/-80°C (lyophilized or liquid)
ApplicationsSDS-PAGE analysisResearch use

Both variants are lyophilized, require reconstitution in glycerol-containing buffers, and are stabilized in Tris/PBS-based storage solutions .

Metabolic Context in Methylococcus capsulatus

M. capsulatus is a methanotroph studied for methane-to-biomass conversion . Though UppP is not explicitly mentioned in its metabolic models , its genome encodes enzymes for:

  • Methane oxidation via pMMO-MDH complexes .

  • Central carbon metabolism modifications (e.g., succinate production via recombinant malate dehydrogenase) .

UppP’s role in M. capsulatus likely parallels its function in other bacteria, supporting cell wall synthesis under stress conditions.

Research and Industrial Implications

  • Antibiotic Resistance: UppP’s bacitracin resistance mechanism could inform strategies to counteract antibiotic tolerance .

  • Bioreactor Applications: Recombinant M. capsulatus strains are engineered for organic acid production , though UppP has not yet been a focus.

Knowledge Gaps

No peer-reviewed studies or patents describe recombinant M. capsulatus UppP. Existing data derive from A. brasilense and E. coli homologs . Further work is needed to:

  • Clone and express M. capsulatus uppP.

  • Characterize its structure-function relationships.

  • Explore its metabolic interplay with methane oxidation pathways.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
uppP; MCA0666; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Target Names
uppP
Target Protein Sequence
MLLPDWLNALILGLVEGLTEFLPVSSTGHLILVGELLKFNDDRGKLFEVVIQSGAILAVC WEYRRKLVELLFGLGHSRQARRFVLNLIIAFLPAGIVGFLAGKAIKAHLFNSTTVTTTFI LGGLIILWVERRQRPPRVESIDDVDWRLALKLGLFQTLAMIPGTSRSGATIIGGLLLGLS RRAATEFSFFLAIPTLFIATAYDLYKTGGILHAEDLSAFGIGFAAAFVSAFLAVRGLLRY IGGHDFTAFAWYRIAFGLVVLSTAHYGLVAWTG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: mca:MCA0666

STRING: 243233.MCA0666

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (UppP) and what role does it play in bacterial cell wall synthesis?

UppP, also known as BacA, is an integral membrane protein involved in bacterial cell wall biosynthesis. It catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), which serves as an essential carrier lipid in the bacterial cell wall synthesis pathway .

The complete pathway involves several steps:

  • Formation of farnesyl diphosphate (FPP) by farnesyl diphosphate synthase

  • Condensation of FPP with 8 additional IPP molecules to form undecaprenyl diphosphate (UPP) by undecaprenyl diphosphate synthase (UPPS)

  • Dephosphorylation of UPP to UP by UppP

  • Use of UP as a carrier for cell wall building blocks

This conversion is a critical step in the recycling of the lipid carrier, making UppP essential for bacterial survival and a potential antibiotic target .

What structural features characterize the UppP active site?

The active site of UppP contains several highly conserved motifs that are critical for its catalytic function:

  • The (E/Q)XXXE motif: This glutamate-rich region is involved in substrate binding and catalysis

  • The PGXSRSXXT motif: This sequence contributes to the active site architecture

  • A conserved histidine residue: Important for the catalytic mechanism

These structural elements are proposed to be located in the periplasmic region of the enzyme. Together, they create a binding pocket that accommodates the lipid substrate UPP and facilitates the dephosphorylation reaction .

How is UppP activity typically measured in laboratory settings?

When assessing UppP activity, researchers employ several methodological approaches:

  • Phosphate release assays: Colorimetric detection of inorganic phosphate released during the dephosphorylation reaction

  • Substrate conversion monitoring: Using techniques like HPLC to measure the conversion of UPP to UP

  • Coupled enzyme assays: Where phosphate release is linked to another enzymatic reaction that produces a detectable signal

Experimental conditions must be carefully controlled, including:

  • Appropriate detergent concentration to maintain protein solubility

  • Buffer composition and pH (typically 7.0-7.5)

  • Presence of divalent cations (often Mg²⁺)

  • Temperature conditions (usually 25-37°C)

For inhibition studies, comparative dose-response curves can be generated, as shown for related enzymes like SaUPPS and EcUPPP .

What are the optimal methods for expressing recombinant M. capsulatus UppP?

Based on established protocols for membrane proteins, recombinant M. capsulatus UppP expression requires careful optimization:

  • Expression system selection:

    • E. coli C41(DE3) strains are commonly used for membrane protein expression

    • Culture growth at 37°C until reaching appropriate density (A₆₀₀ ~0.9)

    • Induction with 0.5 mM IPTG

  • Fusion protein approaches:

    • Creating fusion constructs with proteins like bacteriorhodopsin can improve expression

    • The fusion hybrid approach has been successful with E. coli UPPP and Haloarcula marismortui bacteriorhodopsin

  • Induction conditions:

    • Addition of 5-10 mM all-trans-retinal (when using bacteriorhodopsin fusion)

    • Induction period of approximately 5 hours at 37°C

These methodological details are particularly important as membrane proteins like UppP often present challenges in obtaining sufficient quantities of properly folded, active protein .

What purification strategies yield functional UppP protein?

Purification of functional UppP involves several critical steps:

  • Membrane isolation:

    • Cell disruption using mechanical methods (e.g., Constant Cell Disruption Systems)

    • Membrane collection by ultracentrifugation (40,000 rpm for 1.5 hours)

  • Protein solubilization:

    • Membrane resuspension in appropriate buffer (e.g., 50 mM Tris, pH 7.5, 500 mM NaCl)

    • Solubilization with detergents such as n-dodecyl-β-D-maltoside or other suitable detergents

  • Chromatographic purification:

    • Affinity chromatography (utilizing appropriate tags)

    • Size exclusion chromatography for further purification

  • Activity verification:

    • Functional assays to confirm that the purified protein maintains enzymatic activity

    • Inhibition studies with known inhibitors like bacitracin (IC₅₀ = 32 μM for related UPPP)

How should experiments be designed to evaluate UppP inhibitors?

When designing experiments to evaluate potential UppP inhibitors, researchers should follow these methodological principles:

  • Define variables carefully:

    • Independent variable: Inhibitor concentration

    • Dependent variable: UppP enzymatic activity (measured by phosphate release)

    • Control variables: pH, temperature, detergent concentration, enzyme concentration

  • Include appropriate controls:

    • Negative controls: Reaction mixture without enzyme

    • Positive controls: Known inhibitors (e.g., bacitracin for UPPP)

    • Vehicle controls: Solvent used to dissolve test compounds

  • Determine inhibition parameters:

    • Generate dose-response curves covering a wide concentration range

    • Calculate IC₅₀ values for comparative analysis

    • Determine inhibition mechanism (competitive, non-competitive, etc.)

  • Test for synergistic effects:

    • Combine UppP inhibitors with other antibiotics

    • Calculate fractional inhibitory concentration index (FICI)

    • Values ~0.35 indicate synergism, while values ~1.45 suggest indifferent effects

  • Validate with cellular assays:

    • Measure bacterial growth inhibition (ED₅₀)

    • Compare enzyme inhibition with cellular effects

    • Assess compound logD values to understand membrane permeability

ParameterBasic MeasurementAdvanced Analysis
Enzyme ActivityPhosphate release rateKinetic parameters (Km, Vmax)
InhibitionIC₅₀ determinationMechanism of inhibition
Cellular EffectsGrowth inhibition (ED₅₀)Correlation with enzyme inhibition
SynergismFICI calculationTime-kill curves

What statistical approaches are most appropriate for analyzing UppP activity data?

Statistical analysis of UppP experimental data requires:

  • For dose-response relationships:

    • Nonlinear regression analysis to determine IC₅₀ values

    • Hill coefficient calculation to assess cooperativity

    • 95% confidence intervals to evaluate precision

  • For structure-activity relationships:

    • Correlation analysis between molecular properties (e.g., logD) and activity

    • Multiple regression to identify key structural determinants

    • Principal component analysis to reduce dimensionality of complex datasets

  • For synergy studies:

    • Isobologram analysis to visualize drug interactions

    • Calculation of combination indices

    • Statistical comparison of FICI values (e.g., ANOVA with post-hoc tests)

  • For mutagenesis studies:

    • Comparison of wild-type vs. mutant activity (t-tests or ANOVA)

    • Correlation between structural changes and activity alterations

    • Multiple comparison corrections (e.g., Bonferroni) when testing numerous mutations

When designing experiments, researchers should ensure sufficient replication (minimum n=3) and include appropriate randomization to minimize systematic errors .

How do substrate specificity studies help elucidate UppP's catalytic mechanism?

Substrate specificity studies provide crucial insights into UppP's catalytic mechanism:

  • Experimental approach:

    • Test structurally related substrates with systematic modifications

    • Measure kinetic parameters (Km, kcat) for each substrate

    • Analyze structure-activity relationships

  • Key structural elements to investigate:

    • Length of the isoprenoid chain (C₅₅ in natural substrate)

    • Configuration of phosphate groups

    • Presence of specific functional groups

  • Mechanistic insights:

    • Identification of essential substrate-enzyme interactions

    • Determination of rate-limiting steps

    • Elucidation of the roles of conserved motifs ((E/Q)XXXE and PGXSRSXXT)

  • Correlation with inhibition data:

    • Compare substrate specificity with inhibitor structure-activity relationships

    • Identify substrate-competitive vs. allosteric inhibitors

    • Design transition-state analogs based on mechanism

These studies help resolve mechanistic questions about how the active site residues interact with the substrate and catalyze the dephosphorylation reaction .

What mutagenesis strategies reveal the most about UppP function?

Site-directed mutagenesis provides powerful insights into the structure-function relationship of UppP:

  • Target selection strategy:

    • Conserved residues in the (E/Q)XXXE motif

    • Residues in the PGXSRSXXT motif

    • The conserved histidine residue

    • Residues predicted to interact with the substrate

  • Mutation design principles:

    • Conservative substitutions to probe specific chemical properties

    • Alanine scanning to identify essential residues

    • Introduction of charged residues to test electrostatic hypotheses

  • Functional characterization:

    • Enzymatic activity assays under standardized conditions

    • Substrate binding studies to distinguish binding from catalysis effects

    • Protein stability assessments to confirm proper folding

  • Data interpretation framework:

    • Correlation of activity loss with structural predictions

    • Comparison with related enzymes

    • Integration with computational models

This systematic approach helps determine which residues are directly involved in catalysis versus those that play structural or substrate-binding roles .

How can researchers address challenges in crystallizing membrane proteins like UppP?

Crystallization of membrane proteins like UppP presents significant challenges that can be addressed through these methodological approaches:

  • Construct optimization:

    • Removal of flexible regions that may impede crystal formation

    • Addition of crystallization chaperones like T4 lysozyme

    • Creation of fusion constructs (similar to the bacteriorhodopsin fusion approach used for functional studies)

  • Detergent and lipid screening:

    • Systematic testing of different detergents and detergent mixtures

    • Addition of specific lipids to stabilize the protein

    • Use of lipidic cubic phase (LCP) crystallization methods

  • Crystallization condition optimization:

    • High-throughput screening of precipitants, buffers, and additives

    • Seeding techniques to improve crystal quality

    • Microfluidic approaches for controlled crystallization

  • Alternative structural approaches:

    • Cryo-electron microscopy for structure determination without crystals

    • NMR spectroscopy for dynamic studies

    • Integrative modeling combining low-resolution structural data with computational methods

These strategies have proven successful for other challenging membrane proteins and could be applied to UppP from M. capsulatus .

What correlations exist between UppP inhibitor structure and antimicrobial activity?

Analysis of structure-activity relationships reveals important correlations between inhibitor properties and antimicrobial effects:

  • Key structural features affecting activity:

    • Lipophilicity (logD) correlates with both enzyme inhibition and bacterial growth inhibition

    • Presence of carboxylic acid or phosphonic acid groups is critical for activity

    • Aromatic substitution patterns significantly impact potency

  • Quantitative correlations from experimental data:

    • Compounds with logD values between 3.0-4.7 show optimal activity

    • Most potent compounds (e.g., compound 11) exhibit both low IC₅₀ values against enzymes and low ED₅₀ values against bacteria

    • Dual UPPS/UPPP inhibitors show enhanced cellular activity

The table below illustrates these correlations for selected compounds:

CompoundlogDB. subtilis (ED₅₀, μg/mL)S. aureus (ED₅₀, μg/mL)SaUPPS (IC₅₀, μM)EcUPPP (IC₅₀, μM)
73.50.140.160.322.7
114.70.210.0820.780.83
123.70.530.180.963.4
18-1.623112.56.7
193.6>100>1003.04.2

This data demonstrates that compounds with balanced enzyme inhibition and appropriate physicochemical properties show the strongest antimicrobial activity .

How does the lipid environment affect UppP activity and how can this be studied?

The membrane environment significantly impacts UppP function and can be investigated through:

  • Reconstitution approaches:

    • Proteoliposomes with defined lipid compositions

    • Nanodiscs for controlled membrane environments

    • Detergent-lipid mixed micelles

  • Biophysical characterization methods:

    • Fluorescence spectroscopy to monitor protein conformational changes

    • EPR spectroscopy with spin-labeled lipids to assess protein-lipid interactions

    • Surface plasmon resonance for binding studies

  • Activity correlation analyses:

    • Systematic variation of lipid composition and correlation with activity

    • Investigation of specific lipid requirements

    • Comparison of activity in different membrane mimetics

  • Molecular dynamics simulations:

    • Modeling of enzyme behavior in various lipid environments

    • Prediction of lipid-binding sites

    • Simulation of substrate access pathways through the membrane

Understanding these lipid effects is particularly important for UppP since it processes a lipid substrate and the local membrane environment likely influences substrate presentation and enzyme function .

What computational approaches are most valuable for modeling UppP-substrate interactions?

Computational modeling provides critical insights into UppP function:

  • Sequence-based approaches:

    • Multiple sequence alignment to identify conserved residues

    • Evolutionary coupling analysis to predict residue interactions

    • Homology modeling based on related structures

  • Structure prediction methods:

    • Ab initio modeling for regions without templates

    • Molecular dynamics refinement in membrane environments

    • Model validation through comparison with experimental data

  • Substrate docking and interaction studies:

    • Flexible docking of UPP into the predicted active site

    • Identification of key interaction residues

    • Virtual screening for potential inhibitors

  • Reaction mechanism modeling:

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction pathway analysis

    • Free energy calculations for transition states

    • Identification of potential catalytic residues

These computational approaches complement experimental methods and can guide mutagenesis studies, inhibitor design, and mechanistic investigations .

What are the major contradictions in current UppP research data?

Several unresolved questions and apparent contradictions exist in UppP research:

  • Structural discrepancies:

    • Limited high-resolution structural data creates uncertainty about precise active site architecture

    • Contradictions between computational models and mutagenesis results

    • Uncertainty about the number and location of transmembrane domains

  • Mechanistic controversies:

    • Debate over single-step versus multi-step dephosphorylation mechanisms

    • Conflicting evidence regarding metal ion requirements

    • Uncertainty about the protonation state of catalytic residues

  • Species-specific variations:

    • Differences in inhibitor sensitivity between UppP from different bacterial species

    • Varying reports on essentiality in different organisms

    • Structural differences that may affect drug targeting

Addressing these contradictions requires integrated approaches combining structural biology, enzymology, and computational modeling with standardized experimental conditions to allow direct comparison between studies .

How can advanced experimental design resolve contradictory findings in UppP research?

Resolving contradictions in UppP research requires carefully designed experiments:

  • Standardization approaches:

    • Establish consensus assay conditions for activity measurements

    • Develop reference compounds for inhibition studies

    • Use multiple experimental methods to verify key findings

  • Direct structure determination:

    • Apply cryo-electron microscopy for membrane protein structure determination

    • Utilize advanced crystallization methods specifically designed for membrane proteins

    • Implement hybrid methods combining low-resolution structural data with computational models

  • Comprehensive mutagenesis studies:

    • Systematic alanine scanning of the entire protein

    • Correlation of activity effects with structural predictions

    • Cross-species comparison of equivalent mutations

  • Sophisticated kinetic analyses:

    • Pre-steady-state kinetics to identify reaction intermediates

    • Isotope effects to elucidate rate-limiting steps

    • pH-dependency studies to identify catalytic residues

These methodological approaches follow established principles of experimental design, including proper control groups, minimization of confounding variables, and statistical validation of results .

What emerging technologies might advance UppP research in the next five years?

Several emerging technologies show promise for advancing UppP research:

  • Structural biology innovations:

    • Advanced cryo-EM methods for membrane protein structure determination

    • Microcrystal electron diffraction (MicroED) for small crystals

    • Integrative structural biology combining multiple data sources

  • High-throughput screening approaches:

    • Microfluidic platforms for enzyme assays

    • DNA-encoded libraries for inhibitor discovery

    • Machine learning for predicting structure-activity relationships

  • Genetic and cellular tools:

    • CRISPR-based methods for targeted mutagenesis in native contexts

    • Super-resolution microscopy to visualize enzyme localization

    • Chemical biology approaches using activity-based probes

  • Computational advances:

    • Improved membrane protein structure prediction algorithms

    • Enhanced molecular dynamics simulations with longer timescales

    • Quantum mechanical approaches for reaction mechanism modeling

These technologies will enable researchers to address current limitations in understanding UppP structure, function, and potential as a drug target .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.