Recombinant Methylophilus methylotrophus Methylamine utilization protein mauE (mauE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its development.
Synonyms
mauE; Methylamine utilization protein MauE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Methylophilus methylotrophus (Bacterium W3A1)
Target Names
mauE
Target Protein Sequence
MESMVNDPTVAMFASLFVALVLAAAAIPKLRSQDEFLGVVANYKLLPGFLVAPFAKLLPW LELGCAIALLVPSLRVLAACVAAALFMLFSFAIAVNVGRGRTHIDCGCVRRPTSMSRIGM FHVLRALALAGMSLYVAAVPLEISGISIESALTALASAVMLSLIYMAADLMVGFPATKHK LEIYKGNSND
Uniprot No.

Target Background

Function
Recombinant Methylophilus methylotrophus Methylamine utilization protein mauE (mauE) may be specifically involved in the processing, transport, and/or maturation of the MADH beta-subunit.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MauE protein in Methylophilus methylotrophus and what is its molecular structure?

MauE is a membrane protein that is part of the methylamine utilization (mau) gene cluster in Methylophilus methylotrophus W3A1. The protein consists of 190 amino acids with a molecular mass of 20,159 Da. Structural prediction analysis indicates that MauE contains four transmembrane-spanning helices, suggesting its integration within the cell membrane . This membrane localization is consistent with its predicted function in the transport and processing of methylamine dehydrogenase components.

In comparative studies with related methylotrophs such as Paracoccus denitrificans, MauE has been predicted to contain five transmembrane-spanning helices, suggesting some structural variations across different bacterial species while maintaining its core membrane-associated functionality .

How is the mauE gene organized within the mau gene cluster of Methylophilus methylotrophus?

In Methylophilus methylotrophus W3A1-NS, the mau genes are organized in a specific cluster on the chromosome. Based on sequence analysis of a 6,533-bp region, eight open reading frames have been identified and arranged in the order mauFBEDAGLM . The mauE gene is positioned between mauB (encoding the MADH large subunit) and mauD.

The mau gene cluster in M. methylotrophus W3A1 is notable for lacking two genes that are present in other methylotrophs: mauC (encoding amicyanin) and mauJ (of unknown function). In other studied mau gene clusters, these two genes are typically found between mauA and mauG . This organizational difference may reflect evolutionary adaptations specific to the metabolism of M. methylotrophus.

What is the primary function of MauE in methylamine metabolism?

MauE plays a critical role in methylamine metabolism, particularly in the formation and functioning of methylamine dehydrogenase (MADH). Research with mauE mutants in Paracoccus denitrificans has demonstrated that cells lacking functional MauE are unable to grow on methylamine as a carbon source, while retaining the ability to grow on other C1 compounds .

The specific function of MauE appears to involve the processing, transport, and/or maturation of the beta-subunit of MADH. Analysis of mauE mutants revealed normal levels of amicyanin (the natural electron acceptor for MADH) but undetectable levels of the beta-subunit and reduced levels of the alpha-subunit of MADH . This suggests that MauE's membrane localization allows it to participate in a pathway essential for proper MADH assembly and function, possibly by facilitating the transport of subunits across the membrane or by creating a suitable environment for the maturation process.

What experimental approaches can be used to generate and characterize mauE mutants?

Generating mauE mutants for functional studies primarily involves homologous recombination techniques. Based on methodologies described in the literature, the following approach has proven effective:

  • Vector Construction: Create a suicide vector containing a portion of the mauE gene disrupted by an antibiotic resistance marker (such as the Kmʳ cassette from pUC4K) .

  • Transformation and Selection: Introduce the vector into the target organism and select for transformants with the appropriate antibiotic resistance.

  • Verification of Recombination: Confirm the integration of the disrupted gene into the chromosome by PCR and/or Southern blot analysis using specific probes.

  • Phenotypic Characterization: Assess the mutant's growth capabilities on various substrates, particularly methylamine versus other C1 compounds.

  • Biochemical Analysis: Quantify the levels of relevant proteins (MADH subunits, amicyanin) using immunoblotting or activity assays to determine the specific effects of the mutation.

This approach has successfully demonstrated that mauE mutants lose the ability to grow on methylamine while retaining growth capabilities on other substrates, directly linking MauE function to methylamine metabolism .

How can researchers determine the membrane topology and interaction partners of MauE?

Determining the membrane topology and protein interactions of MauE requires specialized techniques focused on membrane proteins:

Membrane Topology Determination:

  • Hydropathy Analysis: Initial computational prediction using algorithms like those of Rao and Argos or Eisenberg to identify potential membrane-spanning regions .

  • Cysteine Scanning Mutagenesis: Introducing cysteine residues at various positions and using membrane-impermeable thiol-reactive reagents to determine which regions are accessible.

  • Fusion Protein Approaches: Creating fusions with reporter enzymes (e.g., alkaline phosphatase, beta-lactamase) to determine orientation relative to the membrane.

Interaction Partner Identification:

  • Co-immunoprecipitation: Using antibodies against MauE to pull down associated proteins, followed by mass spectrometry identification.

  • Bacterial Two-Hybrid Systems: Modified for membrane proteins to identify potential protein-protein interactions.

  • Cross-linking Studies: Chemical cross-linking of closely associated proteins followed by identification of the complexes.

  • Blue Native PAGE: Separating intact protein complexes to identify stable associations between MauE and other components of the methylamine utilization system.

These approaches can provide crucial insights into how MauE functions within the membrane environment and how it interacts with other components of the methylamine metabolism pathway, particularly the MADH subunits.

What is the relationship between MauE and methylamine dehydrogenase (MADH) assembly and function?

The relationship between MauE and MADH assembly appears to be critical for methylamine metabolism. Research findings suggest a model for this relationship:

Model of MauE's Role in MADH Assembly:

  • Beta-Subunit Processing: MauE is specifically involved in the processing and maturation of the MADH beta-subunit. In mauE mutants, the beta-subunit is undetectable, suggesting either failed synthesis, rapid degradation, or inability to fold properly .

  • Membrane Transport Function: Given its predicted membrane localization, MauE likely facilitates the transport of MADH components across the membrane during the assembly process.

  • Coordination with MauD: MauE functions in concert with MauD, which contains a conserved Cys-Pro-Xaa-Cys motif similar to proteins involved in the biosynthesis of periplasmic enzymes containing heme c and/or disulfide bonds . This suggests a coordinated role in the proper folding and maturation of MADH components.

  • Alpha-Subunit Stabilization: The reduced levels of alpha-subunit in mauE mutants suggest that proper beta-subunit assembly is required for alpha-subunit stability, indicating a sequential assembly process.

This model explains why mauE mutants specifically lose the ability to grow on methylamine while retaining growth capabilities on other C1 compounds – without functional MADH, the first step in methylamine utilization cannot occur.

How do the mau gene clusters and MauE proteins compare across different methylotrophic bacteria?

Comparative analysis of mau gene clusters across methylotrophic bacteria reveals both conservation and divergence:

Table 1: Comparison of mau Gene Clusters Across Methylotrophic Bacteria

OrganismGene OrderMauE Size (aa)MauE Predicted Transmembrane HelicesNotable Features
Methylophilus methylotrophus W3A1mauFBEDAGLM1904Lacks mauC and mauJ genes
Paracoccus denitrificansmauFBEDACJGLMNot specified5Contains complete set including mauC (amicyanin)
Methylobacterium extorquens AM1mauFBEDACJGLMNNot specifiedNot specifiedContains mauN gene downstream of mauM
  • Gene Organization: M. methylotrophus uniquely lacks the mauC and mauJ genes that are present in other methylotrophs .

  • Structural Variations: MauE is predicted to have four transmembrane helices in M. methylotrophus but five in P. denitrificans .

  • Functional Conservation: Despite structural differences, the essential role of MauE in methylamine metabolism appears to be conserved across species, as demonstrated by similar mutant phenotypes .

These comparisons suggest that while the core function of MauE has been conserved during evolution, species-specific adaptations have occurred, possibly reflecting differences in metabolic requirements or environmental niches.

What are common challenges in expressing recombinant MauE and how can they be addressed?

Expressing membrane proteins like MauE presents several challenges that require specific approaches:

Common Challenges and Solutions:

  • Protein Folding and Toxicity:

    • Challenge: Overexpression of membrane proteins often leads to misfolding and host toxicity.

    • Solution: Use tightly regulated expression systems with inducible promoters; express at lower temperatures (16-20°C); use specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21).

  • Membrane Integration:

    • Challenge: Ensuring proper insertion of MauE into the membrane.

    • Solution: Include appropriate signal sequences; co-express with chaperones that assist membrane protein folding; use fusion partners that enhance membrane targeting.

  • Protein Extraction and Purification:

    • Challenge: Solubilizing membrane proteins while maintaining native conformation.

    • Solution: Screen multiple detergents (DDM, LDAO, FC-12) for optimal extraction; use milder purification conditions; consider nanodiscs or amphipols for stabilization.

  • Functional Assays:

    • Challenge: Determining if recombinant MauE is functionally active.

    • Solution: Develop reconstitution systems with MADH components; test complementation of mauE mutants; establish in vitro transport or processing assays.

Addressing these challenges requires an iterative approach, often testing multiple expression constructs, host strains, and purification protocols to identify optimal conditions for producing functional recombinant MauE.

How can researchers investigate the specific sites within MauE that are crucial for its function?

Identifying functional sites within MauE requires targeted mutagenesis approaches combined with functional assays:

Methodological Approach:

  • Sequence-Based Identification of Conserved Regions:

    • Perform multiple sequence alignment of MauE proteins from different organisms.

    • Identify highly conserved residues, particularly those in predicted transmembrane helices or loop regions.

  • Systematic Mutagenesis:

    • Conduct alanine-scanning mutagenesis of conserved residues.

    • Create chimeric proteins between MauE from different species to identify functional domains.

    • Generate targeted mutations based on predicted functional sites (e.g., charged residues in transmembrane regions that might be involved in interactions).

  • Functional Assays:

    • Complement mauE mutant strains with mutated versions and assess growth on methylamine.

    • Quantify MADH subunit levels in complemented strains using immunoblotting.

    • Develop in vitro assays to measure specific functions (e.g., binding to MADH subunits, membrane transport capability).

  • Structural Analysis:

    • If possible, determine the structure of MauE using techniques adapted for membrane proteins (X-ray crystallography of protein-detergent complexes, cryo-EM, or NMR for smaller fragments).

    • Use computational modeling based on homologous proteins if direct structural determination is challenging.

This comprehensive approach can identify specific residues or regions within MauE that are critical for its function in MADH assembly and methylamine metabolism.

What are promising research avenues for understanding the precise molecular mechanism of MauE function?

Several promising research directions could advance our understanding of MauE's molecular function:

  • Structural Biology Approaches:

    • Determine the high-resolution structure of MauE using advanced techniques for membrane proteins.

    • Investigate MauE in complex with its interaction partners to understand the molecular basis of MADH assembly.

  • Real-time Monitoring of MADH Assembly:

    • Develop fluorescently tagged MADH subunits to visualize the assembly process in live cells.

    • Use FRET-based approaches to monitor interactions between MauE and MADH components.

  • Systems Biology Integration:

    • Perform global proteomic and transcriptomic analyses of wild-type versus mauE mutant strains to identify broader effects on cellular physiology.

    • Develop computational models of methylamine metabolism incorporating the role of MauE.

  • Evolution and Adaptation Studies:

    • Investigate the functional significance of the absence of mauC and mauJ in M. methylotrophus compared to other methylotrophs.

    • Explore how different environmental conditions might shape the evolution of the mau gene cluster.

  • Biotechnological Applications:

    • Explore the potential of engineered MauE variants for improved methylamine utilization in bioremediation or biofuel production.

    • Investigate whether MauE's transport/processing function could be repurposed for heterologous protein expression systems.

These research directions could provide deeper insights into the molecular mechanisms of MauE function and potentially lead to biotechnological applications based on methylamine metabolism.

How might the study of MauE inform our broader understanding of membrane protein function in bacterial metabolic systems?

The study of MauE has broader implications for understanding membrane protein function in bacterial metabolism:

  • Membrane Protein Evolution and Specialization:

    • MauE represents a specialized membrane protein evolved specifically for methylamine metabolism.

    • Comparative studies across methylotrophs can reveal how membrane proteins adapt to specific metabolic niches.

  • Protein Transport and Maturation Mechanisms:

    • MauE's role in MADH assembly provides a model system for studying how membrane proteins facilitate the transport and maturation of complex enzymes.

    • The insights gained could be applicable to other bacterial systems where membrane proteins play roles in enzyme assembly.

  • Metabolic Adaptation and Regulation:

    • Understanding how MauE functions within the methylamine utilization pathway can illuminate broader principles of metabolic adaptation in bacteria.

    • The coordination between membrane components (MauE) and soluble enzymes (MADH) represents a common theme in bacterial metabolism that warrants further exploration.

  • Membrane Protein Structure-Function Relationships:

    • The predicted transmembrane topology of MauE and its functional significance can contribute to our understanding of how membrane protein structure relates to function.

    • Insights from MauE could be applicable to other membrane proteins with similar topologies but different functions.

By placing MauE research in this broader context, researchers can contribute not only to our understanding of methylamine metabolism but also to fundamental principles of membrane protein function in bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.