Recombinant Methylophilus methylotrophus Methylamine utilization protein mauF (mauF)

Shipped with Ice Packs
In Stock

Description

Genetic Organization of the mau Gene Cluster

The mau operon in M. methylotrophus W3A1-NS comprises eight genes (mauFBEDAGLM), lacking mauC (amicyanin) and mauJ found in other methylotrophs . Key features:

  • Promoter Region: A functional promoter upstream of mauF drives transcription and has been engineered into the expression vector pAYC229 .

Table 2: Comparative Analysis of mau Gene Clusters

GeneM. methylotrophus W3A1Methylobacterium extorquens AM1Function
mauFPresentPresentMembrane-associated protein
mauCAbsentPresentAmicyanin (electron carrier)
mauJAbsentPresentUnknown

Functional Role in Methylamine Metabolism

MauF is essential for methylamine oxidation:

  • Mutant Studies: mauF knockouts lose the ability to grow on methylamine as a carbon or nitrogen source, indicating its role in amine processing .

  • Pathway Context: Works alongside MauB (methylamine dehydrogenase large subunit) and MauA (small subunit) to oxidize methylamine, likely facilitating electron transfer or substrate channeling .

Recombinant Expression and Applications

Recombinant MauF is commercially produced for research:

  • Expression Systems: Optimized in E. coli with His tags for purification .

  • Research Applications:

    • Study of methylamine metabolic pathways.

    • Structural analysis of bacterial electron transport systems.

    • Biocatalytic engineering for C1 compound utilization .

Key Research Findings

  • Hairpin Structures: The mau operon contains regulatory hairpin structures (>10 kcal/mol stability) within coding regions, suggesting post-transcriptional control mechanisms .

  • Substrate Specificity: M. methylotrophus MauF mutants retain trimethylamine utilization, indicating separate pathways for tertiary amines .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
mauF; Methylamine utilization protein MauF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Methylophilus methylotrophus (Bacterium W3A1)
Target Names
mauF
Target Protein Sequence
MSMNIGATAMSRSSQAYAVETCVPDAYHFSKAQSTGTRFIMMLTAVASGVFAGRVMHSTM SVEMALTGLFVVLAFVGGLLSTWSPCGYSSLSLLRPAGRYSLGAVTRWAPTFFTHAVGYA IGAVVLGGALGGISWLLFADVPLQYAVIGLATLAIGYGLHQFGFLKMPYPQRRAQVPHDA RFRFRSSVIGLLYGFSLGMNYLTYVQTPMLYIVTGVALLSGGVKAGIAVIAVFNIGRCLP VAVNFLPVKDQSVQAWLARWQESAVEVDGFLLLAIASAALMLVML
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Methylamine utilization protein mauF and what role does it play in methylotrophic bacteria?

The Methylamine utilization protein mauF is a component of the methylamine utilization (mau) gene cluster in methylotrophic bacteria such as Methylophilus methylotrophus. It plays a critical role in the methylamine oxidation pathway, which enables these bacteria to utilize methylamine as a carbon and energy source. In the mau gene cluster, mauF is one of nine identified open reading frames (mauFBEDAGLMN) that collectively enable methylamine metabolism .

Research has shown that mauF is essential for methylamine dehydrogenase activity, as mutations in this gene result in bacteria that cannot grow on methylamine as a carbon source. Interestingly, while mauF mutants lack methylamine dehydrogenase activity, they still synthesize both the large and small subunit polypeptides of methylamine dehydrogenase, albeit at altered ratios compared to wild-type bacteria .

How is the mau gene cluster organized in methylotrophic bacteria?

The organization of methylamine utilization genes has been extensively studied in methylotrophic bacteria. In 'Methylobacillus flagellatum' KT, which serves as a model organism for understanding methylamine metabolism, the mau gene cluster consists of nine open reading frames identified as mauFBEDAGLMN .

Additionally, an open reading frame (orf-1) encoding a polypeptide with unknown function has been identified upstream of the mau gene cluster . The genetic organization appears to be conserved across several methylotrophic species, with some variations in gene order and content between different genera such as Methylobacterium extorquens AM1 and Paracoccus denitrificans .

The arrangement of these genes is significant for understanding the regulation and coordination of the methylamine utilization pathway, as mutations in different mau genes result in distinct phenotypes affecting protein production and enzymatic activity .

What are the phenotypic consequences of mutations in different mau genes?

Research on 'Methylobacillus flagellatum' KT has revealed three distinct phenotypic groups among mau mutants:

Group 1: Mutants in mauF, mauB, mauE/D, mauA, mauG, mauL, and mauM

  • Cannot grow on methylamine as a carbon source

  • Lack methylamine dehydrogenase activity

  • Still synthesize both large and small subunit polypeptides, though at altered ratios compared to wild-type

Group 2: Mutants mau-18 and mau-19 (genes not yet identified in the available mau cluster)

  • Cannot grow on methylamine as a carbon source

  • Lack methylamine dehydrogenase activity

  • Do not synthesize methylamine dehydrogenase subunits

Group 3: Mutants in orf-1 and mauN

  • Can grow on methylamine as a carbon source

  • Synthesize wild-type levels of methylamine dehydrogenase

These phenotypic differences highlight the distinct roles of different mau genes in the methylamine utilization pathway. Some genes appear essential for enzyme activity but not for protein synthesis, while others are critical for the expression of methylamine dehydrogenase subunits altogether .

What experimental approaches are recommended for studying mauF function?

To comprehensively study mauF function, researchers should consider implementing the following experimental approaches:

  • Gene Complementation Studies: Construct expression vectors containing the mauF gene to complement mauF-deficient mutants. Measure growth rates on methylamine and methylamine dehydrogenase activity to confirm successful complementation .

  • Site-Directed Mutagenesis: Introduce specific mutations in conserved regions of the mauF gene to identify essential amino acid residues for protein function. This approach can provide insights into structure-function relationships .

  • Protein Expression and Purification: Express the recombinant mauF protein with affinity tags (such as His-tag) for purification and subsequent biochemical and structural studies. Recombinant proteins can be expressed in E. coli expression systems using appropriate vectors .

  • Protein-Protein Interaction Studies: Investigate interactions between mauF and other components of the methylamine utilization system using techniques such as co-immunoprecipitation, bacterial two-hybrid assays, or pull-down assays to understand its role in complex formation.

  • Comparative Analysis: Compare mauF function across different methylotrophic species to identify conserved and species-specific aspects of methylamine metabolism. For instance, while MauM is not required for active methylamine dehydrogenase in some species like Methylobacterium extorquens AM1 and Paracoccus denitrificans, it is essential in 'Methylobacillus flagellatum' .

How should researchers design experiments to investigate interactions between mauF and other mau gene products?

When investigating interactions between mauF and other mau gene products, researchers should consider the following experimental design principles:

  • Factorial Design Approach: Implement a complete or fractional factorial design to efficiently test multiple independent variables simultaneously. This approach is more economical than conducting individual experiments on each factor and can reveal interaction effects between different mau gene products .

For example, a factorial design could investigate how mutations in mauF interact with mutations in other mau genes in affecting:

  • Methylamine dehydrogenase activity

  • Growth rate on methylamine

  • Protein expression levels

  • Cellular localization

  • Control for Confounding Variables: When using fractional factorial designs, be aware of potential aliasing (confounding) of effects. For instance, in a 2^3-1 design with factors A, B, and C, the main effect of A and the B×C interaction can be aliased .

  • Power Analysis: Conduct proper power analysis to determine the appropriate sample size needed to detect meaningful effects, particularly when investigating subtle interactions between gene products .

  • Data Analysis Strategy: Use appropriate statistical methods to analyze main effects and interaction effects. Analysis of variance (ANOVA) is typically used for factorial designs, with post-hoc tests to examine specific contrasts of interest .

What methods are recommended for resolving contradictory findings about mauF function across different studies?

When confronted with contradictory findings about mauF function across different studies, researchers should implement the following methodological approaches:

  • Systematic Review Framework: Develop a structured approach to evaluate the contradicting claims. Categorize studies based on:

    • Experimental organisms used (different methylotrophic species)

    • Methodological approaches

    • Growth conditions and media composition

    • Genetic backgrounds of strains

  • Replication Studies: Design experiments that specifically address the contradictory findings by replicating the original studies with standardized methods and clearly defined controls .

  • Meta-analysis: When sufficient quantitative data are available, perform a meta-analysis to integrate findings across multiple studies, accounting for differences in experimental design and methodological quality .

  • Cross-validation Approaches: Employ multiple complementary techniques to investigate the same question. For example, combine genetic approaches (gene knockouts) with biochemical analysis (enzyme assays) and structural studies (protein crystallography) .

  • Biological Context Analysis: Consider whether contradictory findings might reflect genuine biological differences between experimental systems rather than methodological inconsistencies. For example, the requirement for MauM varies between different methylotrophic species .

What are the optimal conditions for expressing and purifying recombinant mauF protein?

Based on current research practices, the following protocol is recommended for optimal expression and purification of recombinant mauF protein:

Expression System:

  • Use E. coli as the heterologous expression host for recombinant mauF protein

  • Consider BL21(DE3) or other expression strains optimized for membrane or difficult-to-express proteins

  • Construct expression vectors with N-terminal or C-terminal affinity tags (His-tag is commonly used)

Culture Conditions:

  • Grow cultures at 30°C rather than 37°C to minimize inclusion body formation

  • Induce protein expression with IPTG at OD600 of 0.6-0.8

  • After induction, continue incubation at a lower temperature (16-18°C) overnight to enhance proper folding

Purification Protocol:

  • Harvest cells by centrifugation and resuspend in an appropriate buffer (typically Tris-based buffer, pH 8.0)

  • Lyse cells using sonication or cell disruption techniques

  • Centrifuge lysate to separate soluble and insoluble fractions

  • Purify protein using immobilized metal affinity chromatography (IMAC)

  • Consider a second purification step such as size exclusion chromatography

  • Store purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • For long-term storage, add 5-50% glycerol (final concentration) and store at -20°C/-80°C

Quality Control:

  • Verify purity by SDS-PAGE (should be >90%)

  • Confirm identity by Western blotting or mass spectrometry

  • Assess activity using appropriate functional assays

How can researchers effectively analyze the role of mauF in methylamine dehydrogenase activity?

To effectively analyze the role of mauF in methylamine dehydrogenase activity, researchers should employ a multi-faceted approach:

  • Enzyme Activity Assays:

    • Measure methylamine dehydrogenase activity using spectrophotometric assays with artificial electron acceptors such as phenazine methosulfate coupled to dichlorophenolindophenol

    • Compare enzyme activities in wild-type, mauF mutants, and complemented strains

    • Determine kinetic parameters (Km, Vmax) to assess how mauF affects enzyme efficiency

  • Protein Expression Analysis:

    • Quantify methylamine dehydrogenase subunit expression using techniques such as Western blotting or quantitative proteomics

    • Analyze the ratio of large to small subunits in wild-type versus mauF mutants

    • Use pulse-chase experiments to determine if mauF affects protein stability or turnover

  • Subcellular Localization Studies:

    • Use fractionation techniques to determine the cellular localization of methylamine dehydrogenase components in the presence and absence of functional mauF

    • Consider fluorescent protein fusions or immunolocalization to visualize protein distribution

  • Growth Studies:

    • Compare growth kinetics on methylamine versus alternative carbon sources

    • Perform competition experiments between wild-type and mauF mutant strains

    • Analyze adaptation to methylamine growth through serial passaging

  • Gene Expression Analysis:

    • Use RT-qPCR to measure expression of mauF and other mau genes under different growth conditions

    • Determine if mauF plays a role in regulating the expression of other components of the methylamine utilization pathway

How should researchers interpret phenotypic differences between mauF mutants across different methylotrophic species?

When interpreting phenotypic differences between mauF mutants across different methylotrophic species, researchers should consider the following analytical framework:

  • Evolutionary Context Analysis:

    • Construct phylogenetic trees of mauF sequences across different methylotrophic bacteria

    • Map phenotypic differences onto the phylogeny to identify patterns of functional divergence

    • Consider the evolutionary history of methylamine utilization pathways in different lineages

  • Comparative Genomics Approach:

    • Analyze the genomic context of mauF in different species

    • Identify co-occurring genes that might compensate for mauF function in some species

    • Compare the organization of the entire mau gene cluster across species

  • Structural Comparison:

    • Perform sequence alignments of mauF proteins to identify conserved and variable regions

    • Model protein structures to predict how sequence differences might affect function

    • Identify potential species-specific interaction interfaces

  • Interpretation of Functional Differences:

    • Consider that functional differences might reflect genuine biological diversity rather than experimental artifacts

    • For example, while MauM is required for methylamine dehydrogenase activity in 'Methylobacillus flagellatum', it is not required in Methylobacterium extorquens AM1 and Paracoccus denitrificans

    • These differences may reflect adaptations to different ecological niches or metabolic strategies

  • Standardization Approaches:

    • When comparing results across species, ensure experimental conditions are as standardized as possible

    • Consider performing key experiments with multiple species in parallel to minimize methodological variations

What statistical approaches are most appropriate for analyzing data from factorial experiments investigating mauF interactions?

When analyzing data from factorial experiments investigating mauF interactions, researchers should employ the following statistical approaches:

  • Analysis of Variance (ANOVA):

    • Use multifactorial ANOVA to analyze the main effects of different factors and their interactions

    • This approach is particularly appropriate for complete factorial designs where all combinations of factors are tested

  • Contrast Analysis for Fractional Factorial Designs:

    • For fractional factorial designs, carefully analyze which effects are aliased (confounded)

    • Use effect codes to determine which comparisons are valid

    • For example, in a 2^3-1 design, the main effect of factor A might be aliased with the B×C interaction

  • Multiple Comparison Adjustments:

    • When making multiple comparisons, use appropriate correction methods (Bonferroni, Tukey, or false discovery rate adjustments)

    • This reduces the risk of Type I errors when testing multiple hypotheses

  • Mixed Models for Repeated Measures:

    • When experiments include repeated measurements, use mixed-effects models to account for within-subject correlations

    • This approach provides more accurate parameter estimates and valid inference

  • Power Analysis Considerations:

    • Conduct post-hoc power analysis to determine if the experiment had sufficient power to detect effects of interest

    • Use this information to guide the design of follow-up experiments

  • Effect Size Estimation:

    • Report effect sizes in addition to p-values

    • This provides information about the magnitude of effects, which is essential for interpreting biological significance

What are the potential applications of understanding mauF function for broader methylotrophic research?

Understanding mauF function has several important implications for broader methylotrophic research:

  • Bioremediation Applications:

    • Methylotrophic bacteria can degrade various C1 compounds, including environmental pollutants

    • Understanding mauF's role in methylamine metabolism could help optimize strains for bioremediation applications

    • Engineering strains with enhanced methylamine utilization could improve remediation of environments contaminated with methylated amines

  • Biotechnology Applications:

    • Methylotrophs are increasingly important in industrial biotechnology as platforms for producing chemicals from methanol and methylated compounds

    • Knowledge of mauF function could help design more efficient methylotrophic cell factories

    • This could lead to improved production of specialty chemicals, biopolymers, or biofuels

  • Fundamental Understanding of Protein Maturation:

    • The role of mauF in methylamine dehydrogenase synthesis and activity contributes to our understanding of complex enzyme assembly processes

    • This knowledge may be applicable to other systems involving cofactor insertion or protein complex formation

  • Evolutionary Insights:

    • Comparative studies of mauF across different species provide insights into the evolution of C1 metabolism

    • Understanding why some species require mauF while others do not could reveal evolutionary adaptations to different ecological niches

  • Synthetic Biology Applications:

    • The mau gene cluster could serve as a modular component in synthetic biology approaches

    • Understanding the minimal genetic requirements for methylamine utilization could facilitate the transfer of this capability to non-methylotrophic organisms

What are the current gaps in knowledge regarding mauF function and what research approaches might address them?

Several knowledge gaps remain in our understanding of mauF function, along with potential research approaches to address them:

  • Structural Characterization Gap:

    • The three-dimensional structure of mauF has not been determined

    • Research Approach: Use X-ray crystallography or cryo-electron microscopy to solve the structure of purified recombinant mauF protein

    • Alternative Approach: Apply computational modeling techniques such as AlphaFold to predict mauF structure based on sequence information

  • Molecular Mechanism Gap:

    • The precise molecular mechanism by which mauF contributes to methylamine dehydrogenase activity remains unclear

    • Research Approach: Perform site-directed mutagenesis of conserved residues followed by detailed biochemical characterization

    • Alternative Approach: Use hydrogen-deuterium exchange mass spectrometry to identify regions of mauF involved in interactions with other proteins

  • Regulatory Role Gap:

    • Whether mauF plays any regulatory role in methylamine metabolism is unknown

    • Research Approach: Perform transcriptomics and proteomics analyses comparing wild-type and mauF mutant strains under various growth conditions

    • Alternative Approach: Use chromatin immunoprecipitation to investigate if mauF interacts with DNA or transcription factors

  • Species-Specific Function Gap:

    • The reasons for differential requirements for mauF across methylotrophic species are not fully understood

    • Research Approach: Perform cross-species complementation experiments to determine if mauF proteins from different species are functionally interchangeable

    • Alternative Approach: Use comparative genomics to identify co-evolving genes that might explain species-specific requirements

  • Integration with Other Metabolic Pathways Gap:

    • How methylamine utilization interacts with other metabolic pathways in methylotrophs is poorly characterized

    • Research Approach: Use metabolomics approaches to identify metabolic changes in mauF mutants beyond methylamine metabolism

    • Alternative Approach: Construct double mutants affecting both methylamine utilization and other pathways to identify genetic interactions

By addressing these knowledge gaps through targeted research approaches, scientists can develop a more comprehensive understanding of mauF function and its role in methylotrophic metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.