Recombinant Methylotenera mobilis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Context

NADH-quinone oxidoreductase (Complex I) is a critical component of bacterial respiratory chains, facilitating electron transfer from NADH to quinones. In Methylotenera mobilis, the subunit K (nuoK) is a key structural and functional component of this enzyme. Recombinant nuoK refers to a bioengineered version of this protein, expressed and purified for experimental or diagnostic use.

Production and Applications

The recombinant nuoK is commercially available as an ELISA-grade protein (50 µg/vial) for research use, including antibody development, protein interaction studies, and immunological assays .

Contextual Insights from M. mobilis Metabolism

  • Methanol Oxidation: M. mobilis lacks classical methanol dehydrogenase (mxaFI genes) but employs alternative pathways involving XoxF proteins and denitrification-linked enzymes .

  • Oxidative Stress Response: Proteomic studies highlight upregulated oxidative stress enzymes (e.g., catalase, peroxiredoxin) during methanol metabolism, suggesting nuoK’s potential interplay with redox regulation .

Hypothetical Roles

Potential RoleEvidence/Inference
Energy ConservationNuoK’s participation in proton pumping during electron transport
Redox RegulationCoordination with oxidative stress enzymes (e.g., catalase) in methylotrophy
Pathway InterconnectivityLinking methanol oxidation (via XoxF) to denitrification or respiration

Limitations and Knowledge Gaps

  • Lack of Direct Mutant Studies: No published data on nuoK knockout mutants in M. mobilis.

  • Subcellular Localization: Unclear whether nuoK resides in the cytoplasmic membrane or periplasmic space.

  • Regulatory Mechanisms: No identified transcriptional regulators for nuoK in M. mobilis.

Research Priorities

  1. Functional Characterization:

    • Mutagenesis studies to assess nuoK’s role in NADH-quinone oxidoreductase activity.

    • Biochemical assays to measure electron transfer rates and proton pumping efficiency.

  2. Omics Integration:

    • Proteomic profiling of nuoK under varying metabolic conditions (e.g., methanol vs. methylamine).

    • Transcriptomic analysis to identify co-regulated genes in energy metabolism.

  3. Biotechnological Applications:

    • Engineering nuoK variants for enhanced electron transfer efficiency in biofuel production.

    • Development of nuoK-based biosensors for monitoring redox states.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will accommodate your request if possible.
Lead Time
Delivery times may vary based on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
nuoK; Mmol_1596; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Methylotenera mobilis (strain JLW8 / ATCC BAA-1282 / DSM 17540)
Target Names
nuoK
Target Protein Sequence
MVGLSHYLILGSLLFAISVIGIFLNRKNVIILLMAIELMLLAVNLNFIAFSHYLNDVAGQ VFVFFILTVAAAESAIGLAILVVLFRNLRTINVDDLDSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. The immediate electron acceptor for this enzyme in this species is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Methylotenera mobilis and why is it significant for research?

Methylotenera mobilis JLW8 is an obligate methylamine utilizer isolated from Lake Washington sediment. It is an aerobic, Gram-negative bacterium with rod-shaped cells that are motile via a single flagellum . M. mobilis is significant because:

  • It utilizes methylamine as a single source of energy, carbon, and nitrogen

  • It grows optimally at pH 7.5 within a range of pH 5-8.5

  • It oxidizes methylamine via methylamine dehydrogenase and assimilates formaldehyde through the ribulose monophosphate cycle

  • It has a DNA G+C content of 54 mol%

  • It plays a key role in methane cycling in freshwater ecosystems, often co-occurring with methane-oxidizing bacteria

M. mobilis has become increasingly important in studying methylotrophic metabolism and denitrification processes in aquatic environments. Recent research has revealed that Methylotenera populations can be abundant in groundwater samples (comprising up to 35% of sequence abundance in metagenomic data), suggesting their ecological importance extends beyond surface waters .

What is NADH-quinone oxidoreductase and what role does the NuoK subunit play?

NADH-quinone oxidoreductase (Complex I, EC 1.6.5.3) is the first enzyme in the respiratory chain in both bacteria and mitochondria . This enzyme:

  • Catalyzes the oxidation of NADH and reduction of quinone, coupled to proton translocation across the membrane

  • Has an L-shaped structure with a hydrophilic peripheral arm and a hydrophobic membrane arm

  • Contains multiple cofactors including FMN and iron-sulfur clusters involved in electron transfer

  • Is composed of 13-14 subunits in bacteria and 45 different polypeptides in mitochondria

The NuoK subunit (homolog of mitochondrial ND4L) is one of seven hydrophobic subunits in the membrane domain of NDH-1 . It contains three transmembrane segments (TM1-3) and plays a critical role in the proton translocation mechanism. Two conserved glutamic acid residues (Glu-36 in TM2 and Glu-72 in TM3) are particularly important for the energy-coupled activity of NDH-1 .

How do I express and purify recombinant Methylotenera mobilis NuoK?

Expressing and purifying recombinant M. mobilis NuoK requires specific techniques due to its hydrophobic nature as a membrane protein. A methodological approach includes:

  • Gene synthesis and vector construction:

    • Synthesize the nuoK gene (Mmol_1596) based on the M. mobilis JLW8 genome sequence

    • Optimize codon usage for the expression host (typically E. coli)

    • Clone into an expression vector with a suitable tag (His-tag or other affinity tag)

  • Expression conditions:

    • Use E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3))

    • Culture at lower temperatures (16-25°C) after induction to slow protein production

    • Use mild induction conditions (0.1-0.5 mM IPTG)

  • Membrane isolation and protein extraction:

    • Harvest cells and disrupt by sonication or French press

    • Isolate membrane fraction by ultracentrifugation

    • Solubilize using detergents suitable for membrane proteins (DDM, LDAO)

  • Purification steps:

    • Perform affinity chromatography using the fusion tag

    • Apply size exclusion chromatography to remove aggregates

    • Verify protein purity by SDS-PAGE and Western blot

Recombinant NuoK protein should be stored in a buffer containing detergent at concentrations above the critical micelle concentration to maintain stability .

How do mutations in conserved residues affect NuoK function, and what experimental approaches reveal these effects?

Mutations in conserved residues of NuoK significantly impact the function of the NADH-quinone oxidoreductase complex. Research has revealed:

  • Mutation of the highly conserved Glu-36 to alanine results in complete loss of NDH-1 activities, while mutation of Glu-72 leads to moderate reduction in activities

  • Relocation of Glu-36 along TM2 to positions 32, 38, 39, and 40 allows retention of energy transducing activities, suggesting some flexibility in the precise position of this residue within the same helix phase

  • Double mutation of two arginine residues (Arg-25, Arg-26) in the cytoplasmic loop between TM1 and TM2 severely impairs coupled activity, indicating the importance of positively charged residues in this region

Experimental approaches to study these effects include:

TechniqueApplicationKey Measurements
Site-directed mutagenesisGenerate specific amino acid substitutionsN/A
Blue-native gel electrophoresisAssess complex assemblyIntact complex formation
Enzyme activity assaysMeasure electron transfer activitiesNADH:ubiquinone oxidoreductase activity (μmol min⁻¹ mg protein⁻¹)
Proton pumping assaysMeasure proton translocationH⁺/e⁻ ratio
Membrane potential measurementsAssess electrochemical gradient generationmV across membrane

For example, in studies with NuoK mutants from E. coli (homologous system), researchers observed complete assembly of NDH-1 in all point mutants but drastically reduced coupled electron transfer activities in Glu-36 mutants (0-5% of wild-type activity) compared to moderate reductions in Glu-72 mutants (40-60% of wild-type activity) .

What is the relationship between NuoK structure and proton translocation mechanism?

The NuoK subunit plays a crucial role in the proton translocation mechanism of Complex I through specific structural features:

  • The three transmembrane helices of NuoK form part of a proton translocation channel within the membrane domain

  • Conserved glutamic acid residues (particularly Glu-36 in TM2) are likely involved in proton transfer steps

  • The cytoplasmic loop between TM1 and TM2, containing conserved arginine residues, may function in coupling electron transfer to proton translocation

Current models suggest that NuoK participates in a conformational change mechanism where energy released during electron transfer is transduced to the membrane domain, causing structural rearrangements that facilitate proton movement.

The proton path likely involves a series of protonation and deprotonation steps of key residues, with the conserved glutamic acids serving as proton carriers or coordinating water molecules in a proton wire. The exact mechanism remains under investigation, with ongoing research using techniques such as cryo-electron microscopy, molecular dynamics simulations, and site-directed mutagenesis to elucidate the details .

How does the denitrification pathway in Methylotenera mobilis interact with its methylotrophic metabolism?

Methylotenera mobilis exhibits a complex interaction between its denitrification pathway and methylotrophic metabolism that is crucial for its ecological function:

  • M. mobilis can accumulate nitrous oxide when supplemented with nitrate, using methylamine or methanol as electron donors

  • The denitrification pathway in M. mobilis includes a periplasmic nitrate reductase, copper-containing (dissimilatory) nitrite reductase (NirK), NAD(P)-linked (assimilatory) nitrite reductase (NirB), and nitric oxide reductase (NorB)

  • Mutations in denitrification pathway genes significantly reduce nitrous oxide production

  • Only the assimilatory branch of the denitrification pathway is essential for growth on methanol in nitrate-supplemented medium

Table: Nitrous oxide production by M. mobilis wild-type and mutant strains

StrainElectron donorN₂O production (relative to wild-type)
Wild-typeMethylamine100%
Wild-typeMethanol100%
Nitrate reductase mutantMethylamineBackground levels
Nitrate reductase mutantMethanolBackground levels
Dissimilatory nitrite reductase mutantMethylamineBackground levels
Dissimilatory nitrite reductase mutantMethanolBackground levels
Assimilatory nitrite reductase mutantMethylamineBackground levels
Assimilatory nitrite reductase mutantMethanolBackground levels
xoxF1 mutantMethylamine~50%
xoxF1 mutantMethanolBackground levels
xoxF2 mutantMethylamine~50%
xoxF2 mutantMethanolBackground levels
xoxF1/xoxF2 double mutantMethylamine~25%
xoxF1/xoxF2 double mutantMethanolBackground levels

This data demonstrates that the denitrification pathway is operational under aerobic conditions and is intricately linked to the methylotrophic metabolism in M. mobilis .

What techniques are available for studying the electron transfer process in recombinant NuoK?

Several advanced techniques can be employed to study electron transfer processes in recombinant NuoK:

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • Detects unpaired electrons in iron-sulfur clusters

    • Tracks the redox state of electron carriers during enzyme activity

    • Can be combined with freeze-quench techniques for time-resolved studies

  • FTIR difference spectroscopy:

    • Monitors changes in protein structure upon reduction/oxidation

    • Detects protonation/deprotonation events of key residues

    • Can be used with site-specific isotope labeling to identify participating residues

  • Rapid kinetics methods:

    • Stopped-flow spectroscopy to measure rapid electron transfer rates

    • Freeze-quench approaches to trap intermediates for spectroscopic analysis

    • Pre-steady-state kinetics to identify rate-limiting steps

  • Redox potential measurements:

    • Potentiometric titrations to determine midpoint potentials of redox centers

    • Cyclic voltammetry for direct electron transfer measurements

    • Can be combined with site-directed mutagenesis to assess effects of specific residues

  • Cross-linking and mass spectrometry:

    • Identifies proximity relationships between subunits

    • Maps conformational changes during enzyme turnover

    • Provides insights into protein dynamics during electron transfer

These techniques can be applied to purified recombinant NuoK incorporated into proteoliposomes or nanodiscs to mimic the native membrane environment .

How does Methylotenera mobilis contribute to methane cycling in freshwater ecosystems?

Recent research has revealed unexpected roles for Methylotenera mobilis in methane cycling:

Methylotenera species, although not direct methane utilizers, frequently co-occur with methane-oxidizing bacteria such as Methylobacter in freshwater environments . This relationship appears to involve:

  • A metabolic partnership where methane-oxidizing Methylobacter feed methanol and formaldehyde to denitrifying Methylotenera

  • Beneficial exchange of metabolites between these bacteria

  • Possible syntrophic interactions that optimize nutrient cycling

Interestingly, recent research has discovered that one ecotype of Methylotenera may actually produce methane aerobically from methylphosphonate as a phosphate-acquisition strategy . This surprising finding indicates that:

  • Methylotenera may contribute to methane production in oxic freshwater ecosystems

  • This process may help explain the "methane paradox" (methane presence in oxic environments)

  • The bacterium could have dual roles in both methane consumption (indirectly) and production

Metagenomic and proteomic analyses have identified up to 36 different metagenome-assembled genomes (MAGs) of Methylotenera from groundwater samples with varying methane concentrations (from below detection limit to 69 mg/L) . This suggests these organisms are widely distributed in subsurface environments and may play previously unrecognized roles in carbon cycling.

What are the challenges in expressing functional recombinant NuoK and how can they be addressed?

Expressing functional recombinant NuoK presents several challenges due to its nature as a small, hydrophobic membrane protein. These challenges include:

  • Protein misfolding and aggregation:

    • Solution: Use specialized E. coli strains (C41, C43) designed for membrane protein expression

    • Lower expression temperatures (16-20°C) to slow folding

    • Add chemical chaperones (glycerol, trehalose) to stabilize protein structure

  • Protein toxicity to host cells:

    • Solution: Use tightly regulated expression systems

    • Employ autoinduction media for gradual protein expression

    • Utilize low-copy number plasmids to minimize expression levels

  • Extraction from membranes:

    • Solution: Screen multiple detergents for optimal solubilization

    • Use milder detergents (DDM, LMNG) that maintain protein structure

    • Consider nanodiscs or SMALPs (styrene-maleic acid lipid particles) for extraction with native lipids

  • Lack of functionality when isolated:

    • Solution: Co-express with interacting subunits

    • Reconstitute into proteoliposomes with appropriate lipid composition

    • Use amphipols or nanodiscs to maintain native-like membrane environment

  • Verification of proper folding:

    • Solution: Circular dichroism spectroscopy to assess secondary structure

    • Tryptophan fluorescence to monitor tertiary structure

    • Binding assays with known ligands or inhibitors

A methodical approach combining these strategies has proven successful in expressing and characterizing related membrane proteins from respiratory complexes .

How can genetic manipulation of Methylotenera mobilis advance our understanding of NuoK function?

Genetic manipulation of Methylotenera mobilis provides valuable insights into NuoK function within its native context. The following methodological approaches have proven effective:

  • Targeted gene deletion:

    • Homologous recombination techniques to generate nuoK knockout strains

    • Analysis of growth phenotypes on different carbon sources

    • Measurement of respiratory activities in membrane preparations

    • Complementation with wild-type and mutant alleles

  • Site-directed mutagenesis of conserved residues:

    • Mutation of key residues (Glu-36, Glu-72) to analyze functional importance

    • Creation of conservative mutations (Glu→Asp) versus non-conservative (Glu→Ala)

    • Assessment of functional consequences through activity measurements

  • Reporter gene fusions:

    • Creation of nuoK-reporter gene fusions to study expression patterns

    • Analysis of transcriptional regulation under different growth conditions

    • Investigation of post-transcriptional control mechanisms

  • Protein tagging for localization studies:

    • Addition of fluorescent protein tags for localization studies

    • Use of epitope tags for immunodetection and co-immunoprecipitation

    • Application of split-protein complementation assays to study protein-protein interactions

For example, previous research created point mutations in M. mobilis NuoK targeting glutamic acid residues and demonstrated their importance for coupled electron transfer and nitrous oxide production . These studies revealed that mutations in NuoK's conserved acidic residues significantly impacted denitrification pathway function, highlighting the interconnection between respiratory complex function and nitrogen metabolism in this organism.

What emerging technologies could enhance our understanding of NuoK structure-function relationships?

Several cutting-edge technologies show promise for advancing our understanding of NuoK:

  • Cryo-electron microscopy (cryo-EM):

    • Near-atomic resolution structures of membrane protein complexes

    • Visualization of different conformational states during catalytic cycle

    • Mapping of water molecules and proton pathways within the complex

  • Mass spectrometry-based techniques:

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Cross-linking mass spectrometry to identify subunit interactions

    • Native mass spectrometry to study intact membrane protein complexes

  • Advanced computational methods:

    • Molecular dynamics simulations to model proton transfer pathways

    • Quantum mechanics/molecular mechanics calculations for redox reactions

    • Machine learning approaches to predict functional effects of mutations

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to measure conformational changes

    • Atomic force microscopy to study membrane protein topology

    • Optical tweezers to measure forces generated during proton pumping

  • Synthetic biology approaches:

    • Minimal synthetic systems to test specific aspects of NuoK function

    • Designer membrane proteins with modified properties to test mechanistic hypotheses

    • Cell-free expression systems for rapid protein engineering and screening

These technologies, used in combination, could provide unprecedented insights into how NuoK contributes to the proton pumping mechanism of Complex I and its role in cellular energy metabolism .

How do variations in NuoK across different Methylotenera species influence their ecological roles?

Genomic and metagenomic analyses have revealed significant variations in NuoK and other respiratory complex components across different Methylotenera ecotypes, which may influence their ecological roles:

  • Comparative genomic analysis of three Methylotenera representatives (M. mobilis JLW8, M. versatilis 301, and M. glucosetrophus SIP3-4) from Lake Washington showed significant divergence in gene content and conservation

  • The core genome of Methylophilaceae may be as small as approximately 600 genes, while the pangenome may be as large as approximately 6,000 genes

  • Significant variations exist in genes involved in methylotrophy and respiratory pathways across species

These variations likely contribute to:

  • Differential substrate utilization capabilities

  • Varied denitrification pathway functionalities

  • Distinct ecological niches within the same environment

  • Different partnerships with methanotrophic bacteria

  • Varying responses to environmental changes (oxygen levels, nitrogen availability)

Recent metagenomic analyses identified three distinct groundwater ecotypes of Methylotenera, with one ecotype appearing to produce methane aerobically from methylphosphonate . This suggests that evolutionary diversification of energy-generating pathways, including variations in respiratory complex components like NuoK, has enabled Methylotenera species to occupy specialized niches and perform non-redundant functions in carbon and nitrogen cycling.

A methodological approach to studying these variations includes comparative genomics, transcriptomics, and proteomics of different Methylotenera species under controlled laboratory conditions and in environmental samples .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.